SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331271.Bcen_6403 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331271.Bcen_6403
Domain Number 1 Region: 137-391
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.62e-62
Family D-glucarate dehydratase-like 0.001
Further Details:      
 
Domain Number 2 Region: 40-154
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.65e-27
Family Enolase N-terminal domain-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 331271.Bcen_6403
Sequence length 392
Comment (Burkholderia cenocepacia AU 1054)
Sequence
MSMPTIRAVRALTVRGGGADYHDQDAGHWIDDHIATPMSRYPEYRQSRQSFGINVLGTLV
IEVEASDGTVGFAVTTGGEIGAFIVERHLARFIEGQRVTDIEKMWDQMFHATLYYGRKGV
VLNAISGVDLALWDLLAKVRREPVHQLLGGKVRDELEFYATGARPDLAKEMGFIGGKLPL
HHGPAEGEAGLRRNLDALADMRSRVGADFWLMLDCWMSLDVPYATRLAHEAHALGLKWIE
ECLPPDDYWGYAKLRRDVPRGMLVTTGEHEATRWGFRMLLEMECCDIIQPDVGWCGGLTE
LMRISALADARGVLVIPHGSSVYSYHFVTTRHNSPFAEFLMMAPQADRVVPMFDPLLLDE
PVPVGGRMKVPDTPGFGVRLNPDVRMQRPYEH
Download sequence
Identical sequences A0A1U9N3U8 A0KDV2 Q1BGJ0
331271.Bcen_6403 331272.Bcen2424_6636 gi|116687011|ref|YP_840258.1| gi|107029143|ref|YP_626238.1| WP_011549800.1.21535 WP_011549800.1.24953 WP_011549800.1.27194 WP_011549800.1.43430 WP_011549800.1.4378 WP_011549800.1.50701 WP_011549800.1.5376 WP_011549800.1.88043 WP_011549800.1.90674 WP_011549800.1.95150 WP_011549800.1.96618 WP_011549800.1.9804 WP_011549800.1.98478 WP_011549800.1.98955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]