SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331272.Bcen2424_4576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331272.Bcen2424_4576
Domain Number 1 Region: 451-560
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000746
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331272.Bcen2424_4576
Sequence length 572
Comment (Burkholderia cenocepacia HI2424)
Sequence
MQDSNESRSSRVRLLKGILPVRRAAAMRDIFAGMSLASMDIPQVLGYARIAGMPAVTGLY
TVFLPLVAFACFGASRHLVVAADSATATIFASRLSSMAPAGSADYAALAGMVALLTAAML
LLARIFKLGFLADFLSRTVLVGFLAGVGVQVSIAMLGDMLGLSVPYPASRSLAQLDYVVT
HLVHAHRPTLALAALVVGAILACKRFLPRVPMPMIAVAGSIAASAAFGFAAHGIAVLGPV
AGGLPPLRWPSVTWQQFLDLVPVAASCFVMIIAQSAAAARVFAQQYGEDVDTNADILGLA
AANAAAALGGAFVVNGSPTQTAMADGAGVRSQIGHLAFAVVVAVVLLFFSPYLQYLPHAV
LAGIVFTIALGLINVRSLAAIREESPGEFTLALITAAAVVTVGVEQGILLAVALSLMRHV
RHSYQPHTMVLEPVAGNGRWQPVPTRRGAMTAPGLIVYRFGADLFFANDHLFAAEVTELV
DAAPLPPRWFVVDAGAITDVDYSAARTLADLVRALHARGIGVLFGRVNRYLRADMDRHGI
TEVVGASCIFATLHQALEAAGTTPAPQEPGTV
Download sequence
Identical sequences A0A1U9MYM0 B1K3G6
331272.Bcen2424_4576 406425.Bcenmc03_5729 WP_011694769.1.21535 WP_011694769.1.24953 WP_011694769.1.27194 WP_011694769.1.43430 WP_011694769.1.4378 WP_011694769.1.50701 WP_011694769.1.5376 WP_011694769.1.88043 WP_011694769.1.90614 WP_011694769.1.90674 WP_011694769.1.95150 WP_011694769.1.96618 WP_011694769.1.9804 WP_011694769.1.98478 WP_011694769.1.98955 gi|170738081|ref|YP_001779341.1| gi|116692670|ref|YP_838203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]