SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331678.Cphamn1_0589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331678.Cphamn1_0589
Domain Number 1 Region: 797-1180
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.3e-121
Family PFOR PP module 0.0000000217
Further Details:      
 
Domain Number 2 Region: 420-670
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 9.02e-79
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000817
Further Details:      
 
Domain Number 3 Region: 7-260
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.35e-72
Family PFOR Pyr module 0.0000000803
Further Details:      
 
Domain Number 4 Region: 261-418
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.31e-49
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000111
Further Details:      
 
Domain Number 5 Region: 669-841
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6e-20
Family Ferredoxin domains from multidomain proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 331678.Cphamn1_0589
Sequence length 1182
Comment (Chlorobium phaeobacteroides BS1)
Sequence
MTKSRIYKTMEGNEALAYVAYRTNEVISIYPITPASNMGEYSDEWASEGLQNVWGSVPLV
DEMQSEAGAAAAVHGAVQTGALTTTFTAAQGLLLMIPTMYKIAGELSPCTIHVSARSLAC
QALSIFGDHGDVMSVRGTGFALLASCSGQEVMDLALIAQAATLESRIPFLHFFDGFRTSH
EITKIEMLSDEQIKSMIDDDLVIAHRNRRMSPDQPIIRGTSQNPDVYFQGRETVNPFYLA
CPDIVEKQMEKFTEMTGREYKLYQYYGAPDADRVIVMMGSGAETALETVEYLNKKGEKVG
LIKVRLYRPFDVKRFLAALPSSVTSIAVLDRLKEPGSAGEPLYLDVVNAVHEGMEEGHPE
IVGGRYGLSSKEFTPAMVMAVFENLSQKEPKSHFTIGINDDVSFSSLNYDDSICIEDDSV
FRAMFYGLGSDGTVGANKNTIKIIGENTENYAQGYFVYDSKKAGSITVSHLRFGPEPIRS
AYKVSTANFIGCHLWIFLESIDLVKNLKEGGTLLVNSHYSPDELWDQLPKHVQEHLIQKK
AKLYTIDAYEVAEKSNMGLRINTIMQACFFAISGILPREEALEKIKQSIRDTYGKKGDDI
VNQNIQAVENSVSNLHEVKIGSIADSKKSMRPPISGEAPEFVCNTLAKIISGDGDDIPVS
QMPPDGTFPVSTSKFEKRNLAEKVPVWEADVCIQCGKCAFMCPHGVIRSKAYDPKYLGNA
PKTFKNIDAKGKNWEGLKYTIQVAVEDCTGCEICAHICPASDKKNPERHALNMSLQAPIR
ENEIDNWNYFLNIPEFDRGKINTRLIKEQQLQQPLFEFSGACTGCGETPYVKLITQLFGD
RLVLGNATGCSSIYGGNLPTTPFCTNTDGLGPTWSNSLFEDTAEFAMGFRISINKQKEFA
EEMVKALSAEIGDTLTGEILNASQKSEPEIFEQRKRVHVLKEKLAVMDNPMAKNLLAVAD
MLVKKSVWGIGGDGWAYDIGYSGVDHITASSENVNLLVLDTEVYSNTGGQASKATPKAAV
AKFAAAGRPLQKKDLGMISMTYGNAYVASIAMGARDEHTLKAFLEAEAYDGPSVIIAYSH
CIAHGIDMAVGMEHQKAAVDSGHWLLYRYNPDRRNEGKNPLSLDSKKPKIPVEQFLNMEN
RFRMLKKSHPDLAKEFFAEIQQEVDARYATYEYLAARKFEND
Download sequence
Identical sequences B3EMS0
gi|189499559|ref|YP_001959029.1| 331678.Cphamn1_0589 WP_012474039.1.36401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]