SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331678.Cphamn1_1169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  331678.Cphamn1_1169
Domain Number 1 Region: 23-190
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.42e-31
Family Clp protease, ClpP subunit 0.053
Further Details:      
 
Domain Number 2 Region: 363-429
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000353
Family NfeD domain-like 0.0095
Further Details:      
 
Weak hits

Sequence:  331678.Cphamn1_1169
Domain Number - Region: 167-243
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0222
Family MgtE N-terminal domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331678.Cphamn1_1169
Sequence length 434
Comment (Chlorobium phaeobacteroides BS1)
Sequence
MIVLLLFAAVTVFSSTLRAEEAKGNKTVLFLSLQGTVNPGSADFFERAIDQAEKEKVHAI
LVELDTPGGLVSSLRAMVQSVLASPVPVIVYVAPQGAQAASAGALLTLSAHVAAMSPGTE
IGAAHPVGLGGGGDGDETMSKKAENDLAAFARSIAEERGRNAEWAENAVRESIASTANEA
LKAGVIDFVAADRAELFRMLDGRTVETIDGSLTLDLTGAVIEEFSPTLQEQILIKLADPN
LAYIFIMVGLAGLYFELANPGSIFPGVLGAISLLLALFALQALPVNVVGVLLIVLAVVFF
GLELFVASGGILALAGLVALFVGSLMLFNTAETGISISMTVFLPVFIMVSVSLLAIVWLV
TKSSRLKLSSGPEQLIGEEGSVIHAILPGQPGKVFVHGELWDAESGEEIPEKGVAIVKGL
KGLILQVTKKQENV
Download sequence
Identical sequences B3EQS2
331678.Cphamn1_1169 gi|189500114|ref|YP_001959584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]