SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 331678.Cphamn1_1947 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  331678.Cphamn1_1947
Domain Number - Region: 5-84
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.00239
Family Family 1 bi-partite nucleotidyltransferase subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 331678.Cphamn1_1947
Sequence length 111
Comment (Chlorobium phaeobacteroides BS1)
Sequence
MSKRDWKLFLEDILESIEWIEDFIKGMDAESFACDRKTVDAVVRNFEIIGEAAKSIPVDI
RERHQGVDWSGMIGLRNRIAHEYFGLSLPIIWKIAVDDLPKLKNEIIRIEE
Download sequence
Identical sequences B3EM18
gi|189500870|ref|YP_001960340.1| gi|189500881|ref|YP_001960351.1| 331678.Cphamn1_1947 331678.Cphamn1_1958 WP_012475335.1.36401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]