SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 331678.Cphamn1_2152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  331678.Cphamn1_2152
Domain Number - Region: 411-523
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0301
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 331678.Cphamn1_2152
Sequence length 596
Comment (Chlorobium phaeobacteroides BS1)
Sequence
MAPVKHPPEWQKFFTSAVEEKKPLAPVAAKITSPTRRPHVIYPLPLSRIAAKKLFEDYLK
KNTKVSKSIRWSNSKRGWYMKSQLGNAKYWRSYHLWPATLKNELKRMFIRHALEPGNRLF
SLDATKTAFTFEEVREVYLSYVAHSLYLDIFRIVPWKLEAFDDVQLRWLFDGRYFAFNFA
VEVDKKNLPDATSKYCFGYVEKRNSEIDPWNYYPIATPALPGDPALLFEKLSSDLALHKS
PTLRESVSGVARWCQNNLSHGQTSYAWGGGVFTGSSWVDQLYPSSEVIYLGRMDQHYIRR
FRQKLNGAYITPRLPAGVSVAQLVDKRGVFADPAMGQLDAQGNLQPPSKIGFMKHCTYSG
CQTTGGLLHWLFKAINVPACQYSCFMGDVVAGNYPGAFHKGIEVSVGQTETVVVGHSDHL
YQGMGIYHPDIPGGTFVAHFRDPHIDLLKVFLPKNFQEWWLPPYNISSATADPAAYGSRQ
NELYYTQMIMTGAVGAFSSYVIDWWKAYEQAGRVVSNMNTATIPWMVLLNKLAMPAGVLA
SVLNLAETNIRSRIDDIENGVNTQWGTTLADYEAGFLQWDQDLYDSKAGATIWTSP
Download sequence
Identical sequences B3EN68
gi|189501068|ref|YP_001960538.1| WP_012475523.1.36401 331678.Cphamn1_2152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]