SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33169.AGOS_ABL109W from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33169.AGOS_ABL109W
Domain Number 1 Region: 63-104,134-219
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.71e-37
Family ATP-dependent riboflavin kinase-like 0.0000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33169.AGOS_ABL109W
Sequence length 222
Comment (Eremothecium gossypii)
Sequence
MPCISAYVIYSQVEKLPFSMNFISQHSVFTLKDCCEMARRPVDIPIPASPVQPFPILTEY
VDIVAGFGRGSAELGIPTANVPIEQLPSEVNEMATGVYFGWARLRPNMDQEAQVHHRNDG
SEVIYNFGSKLSETERGVFPIVLSVGWNPFYNNSKKTVELHILNDFEEDFYGAKIKFSFL
GYIRPELNYTTKEALIEDIHTDIKIASEVLHTEPYSSLKNQL
Download sequence
Identical sequences 33169.AGOS_ABL109W NP_982838.1.49492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]