SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00007014 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00007014
Domain Number 1 Region: 21-138
Classification Level Classification E-value
Superfamily Histone-fold 2.58e-51
Family Nucleosome core histones 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00007014
Sequence length 140
Comment (Aspergillus terreus)
Sequence
MPPKAAEKKPTTGGKAPAGKAPAEKKEAGKKTAAAASGDKKKRGKTRKETYSSYIYKVLK
QVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSAK
Download sequence
Identical sequences Q0CBD1
XP_001217589.1.65242 ATET_09003 33178.CADATEAP00007014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]