SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 33178.CADATEAP00007578 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  33178.CADATEAP00007578
Domain Number 1 Region: 159-406
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-62
Family D-glucarate dehydratase-like 0.000000219
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.65e-32
Family Enolase N-terminal domain-like 0.000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 33178.CADATEAP00007578
Sequence length 426
Comment (Aspergillus terreus)
Sequence
MNAAGDYSSAYCILYTDSSYAGHGMTFTIGRGNEIVCSAISLLAPLVIGKDLDELTADWG
KTWRYLVSDSQLRWIGPEKGVIHLALGAVVNALWDLWAKILGKPVWRIVAEMTPEEVVRC
IDFRYITDALTPEEALALLKEVEPGKAERIRDAEQNRAVPAYTTSAGWLGYSEEKLKALL
ADSVAQGYRHFKLKVGANLEEDKRRLTIAREAIGYDKGNILMVDANQVWSVPEAITWMKE
LAQFKPWFIEEPTSPDDILGHAAIKKALEDTPYGPIGVATGEMCQNRVIFKQLLQAGALT
VLQADACRVGGVNEVLAILLLARKFGVPIVPHSGGVGLPEYTQHLSTIDYVVVSGKRSVL
EYVDHLHEHFVHPSSVKDGYYVTPTEPGYSVEMKADSMDAFSYPGEEGKSWWKSEAAKPI
LEGPRI
Download sequence
Identical sequences Q0CPH3
33178.CADATEAP00007578 XP_001213589.1.65242 ATET_04411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]