SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 332648.A6S5C6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6S5C6
Domain Number 1 Region: 186-429
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.54e-62
Family D-glucarate dehydratase-like 0.000000392
Further Details:      
 
Domain Number 2 Region: 5-139
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.55e-38
Family Enolase N-terminal domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 332648.A6S5C6
Sequence length 450
Comment (Botryotinia fuckeliana B05.10)
Sequence
MAEVTITGWDTRDVRFPTSLDKTGSDAMNAAGDYSSAYCILKTDSEFSGHGMTFTIGRGN
DIVCAAIDHVADRLKGRTLSSLVSNWGQTWRYLVSDSQLRWIGPEKGVIHLALGAVVNAI
WDLWAKTLNKPVWRIVADMSPEEFVSCIDFRYITDAITPEEAIAMLKAEEGGKAKRIEDA
LNNKAVPAYTTSAGWLGYGKDKMKGLLEETLAKGYRHFKLKVGTSVEDDRERLSIAREVI
GYDKGNILMVDANQVWSVPEAIEYMQQLKEFKPWFIEEPTSPDDILGHKAIREALKPYGI
GVATGEMCQNRVIFKQLLASGAIDVCQIDACRMGGVNEVLAVLLMAKKFGVPIVPHSGGV
GLPEYTQHLSTIDYVVVSGKLSVLEYVDHLHEHFEHPSVIKGGYYQTPLEPGYSVEMKAA
SMDQFEYPGKDGVSWWKSEEAKPILEGIKI
Download sequence
Identical sequences G2XN55
BC1T_08318 332648.A6S5C6 XP_001553594.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]