SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 332648.A6SPB7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  332648.A6SPB7
Domain Number 1 Region: 22-125
Classification Level Classification E-value
Superfamily POZ domain 1.41e-17
Family Tetramerization domain of potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 332648.A6SPB7
Sequence length 223
Comment (Botryotinia fuckeliana B05.10)
Sequence
MSASANPNARGKNRLAPAAGGPITLQVGERRFVTTMNTMTGESPFFAALLSGRWDSNEQA
DGSYFIDADPDLFEHILRYLRRSVLPIFYDPIKGHDHALYLALLGEARYFQITRLENYLK
NEIYLSAVKTCSSVEELEGFWSETQSTDESVEYYPRWDTKKVYICPRGIGVHRGNSSACG
RQCESVRGDSEYIYEDEPVLKTLVIRKQLVVDQTACMEGLDEE
Download sequence
Identical sequences M7TIU4
332648.A6SPB7 BC1T_14806 XP_001546854.1.26476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]