SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 334390.LAF_0246 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  334390.LAF_0246
Domain Number - Region: 116-147
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0488
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 334390.LAF_0246
Sequence length 151
Comment (Lactobacillus fermentum IFO 3956)
Sequence
MTNQELQNLVERWSQESFGRPFLHQAVFNRRLKTTGGRYHLGDHHIDINPLMLEEYDLAT
LKQVVLHELCHYHLHLTGRGFGHRDRDFKALLMQVGGSRYAPPTSKARRPGGVVVRYRYR
CTGCGLIIGRNRRFNLACFVCRRCGHRFEEI
Download sequence
Identical sequences B2GAA0 C0WVF8
gi|184154722|ref|YP_001843062.1| WP_004562723.1.36713 WP_004562723.1.58986 334390.LAF_0246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]