SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 334413.FMG_0773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  334413.FMG_0773
Domain Number 1 Region: 142-205
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000706
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 334413.FMG_0773
Sequence length 205
Comment (Finegoldia magna ATCC 29328)
Sequence
MSIFSYHILSMIFLSVTFVSITVLMLSNKKFKYGLLTAVFSVLFILSYYNHGDIDIIGIL
VFLIGLLFVGLELIVPGGFIAGIIGVLSMIVGISMIINNLYLAFLTVVIAITIDVLFILV
FLSKEFDSSKFNKFVLKETNSKSFTQTSKKYLNKKGTTITPLRPSGKVEIDGNYIDAITR
GDFIPKGCEVVVSEIKDFKIIVRRV
Download sequence
Identical sequences B0S1F1 E1KVT6
334413.FMG_0773 gi|169824470|ref|YP_001692081.1| WP_002839037.1.14644 WP_002839037.1.74057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]