SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335283.Neut_1602 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  335283.Neut_1602
Domain Number - Region: 127-177
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000667
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 335283.Neut_1602
Sequence length 227
Comment (Nitrosomonas eutropha C71)
Sequence
MSADNLLLDFTSPGAIPPDPVEEIQRIVNETQIKMQALESLLENEQVEDVAGWKLLAMFY
LATDRVNDLAKIERLYKNIAGVSLSAGLKQKYTRWFNEEAASNPIVFEIPKKITAETLPA
NMIIQCSRSSPGDILLDFSNVQEIDNDGLRKLAKLFSSMTRESIKLELKQINHFIASLQN
KAEASTNTRAIWDVLFAYERLQDNRKAFEEKAIQFAILYGISPPSWE
Download sequence
Identical sequences A0A1G4V1H1 Q0AFN7
gi|114331588|ref|YP_747810.1| WP_011634651.1.19561 WP_011634651.1.26249 WP_011634651.1.94036 WP_011634651.1.95726 335283.Neut_1602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]