SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335284.Pcryo_2069 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335284.Pcryo_2069
Domain Number 1 Region: 455-564
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 335284.Pcryo_2069
Sequence length 570
Comment (Psychrobacter cryohalolentis K5)
Sequence
MPSIATRLIPVWLRQYQLSALPTDIIAGIVVGVLVIPQSLGYAVLAGLPPVYGLYAAIVP
VAVYAWLGSSNVQAVGPAAVTAIMTASALHPYADKGAEQYVLMAALLALMMGAILWLAGQ
LKLGWIMQFISRGVSAGFISGAAVLIFISQLKYLTGIPISGDGLIGYLSSMQMYANQLHP
LTLVIGISAFALMLLNRYGKKWVWQSWLSASYAKWAERLFPLILLTAAIALSIVLHWTTS
GVATIGNVPKGLPSFTAPYLPDFHEALNLLPTAGLMALIAFVSSSSVASTYARLRGELFD
ANRELTGLGLANVAGSFFQSFPIAGGFSRTAINVDSGAKTPLASLVTVLVMIAALIAFGY
LLAPLPYAILGATIMAAIIGLIDIATLKSAWHRDRLDAASFIAAFVGVLIFGLNTGLVIG
LMVSFASLIWQSSKPHVAIVGQLAGTGHFRNINRHDVVTFHNLLMLRIDESLFFGNSESV
HRHVVQATRQYPEASEIILIMSAVNHIDLTGQEMLISLNQELLNQNKHLSFSFIKGPVMD
IIEHTPVITDLSGHVYLSTMDAVNGLKDTH
Download sequence
Identical sequences Q1Q907
gi|93006893|ref|YP_581330.1| 335284.Pcryo_2069 WP_011514386.1.38006 WP_011514386.1.88559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]