SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335284.Pcryo_2452 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  335284.Pcryo_2452
Domain Number - Region: 84-152
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00209
Family NfeD domain-like 0.0049
Further Details:      
 
Domain Number - Region: 33-116
Classification Level Classification E-value
Superfamily Carbon-nitrogen hydrolase 0.00549
Family Carbamilase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 335284.Pcryo_2452
Sequence length 165
Comment (Psychrobacter cryohalolentis K5)
Sequence
MMETLWMIEPWHWLVLGFSLLIVEMFVPTFASLWFGAAAIIVAALAWLLPVSVSVQIIIW
LLLSAIFLLAWFKFIKPLSVDRTKAGLGGSVIVGETGMIIAQPQPDRAGMVRFNVPIVGA
TEWMCRTRGEQVAVGDRVVVTDIVGNELIVSSMTSKAAVNQNMRV
Download sequence
Identical sequences Q1Q7X4
WP_011514750.1.38006 WP_011514750.1.88559 335284.Pcryo_2452 gi|93007276|ref|YP_581713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]