SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335541.Swol_0441 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  335541.Swol_0441
Domain Number - Region: 15-132
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00683
Family Enolase 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 335541.Swol_0441
Sequence length 161
Comment (Syntrophomonas wolfei Goettingen)
Sequence
MPGAEENNIINCNEGLSKGGAGLDLKEIVIRKNGKWYFGQAEMFRRNILNILAAHIQKED
GDYVIRLGNDVNPITVEDCPFLAMGYIEEEDGTIKLRFHDLQEMKLDHELKITFKGDVPY
IDFKWEADTRLSRGVYWKLSNYFDFRGDEVYIVPPGARLEQ
Download sequence
Identical sequences Q0AZS6
WP_011639886.1.6463 335541.Swol_0441 gi|114565995|ref|YP_753149.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]