SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335541.Swol_1862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335541.Swol_1862
Domain Number 1 Region: 79-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000301
Family NfeD domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 335541.Swol_1862
Sequence length 146
Comment (Syntrophomonas wolfei Goettingen)
Sequence
MSSLQWILIAVVFGAIEIFTVGLWFLWLALSALLVAAAAALKLLPGLEVQLLLFAFFTLL
FILFTRPLVLKFFKTNDTASNVKALVGQHGICLSSITPLEYGQVKVNGEVWTAFSPQEIE
EDTRIVVAGIDGVKLLVEKAELETSK
Download sequence
Identical sequences Q0AVU4
WP_011641255.1.6463 335541.Swol_1862 gi|114567377|ref|YP_754531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]