SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335543.Sfum_0465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335543.Sfum_0465
Domain Number 1 Region: 43-211
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.7e-28
Family Clp protease, ClpP subunit 0.028
Further Details:      
 
Domain Number 2 Region: 387-449
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000209
Family NfeD domain-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 335543.Sfum_0465
Sequence length 451
Comment (Syntrophobacter fumaroxidans MPOB)
Sequence
MSLSRHPRGGFEMLKSLYARIPFHAAWFLVVGALVLFPFNGCIAGSDHVNIVEIQDTINP
GVEDFIRYAVATSEEDGAQFLVILLDTPGGLLTSTRGIAQAILNAKVPIVVYVYPSGAQA
ASAGVFITAAADIAAMAPGTNIGAAHPVMGGGENVPSTMDEKVLNDTLAFSRSIAAQRGR
NAEWLEQSIRRSVSATAEEAFKENVIDLVADDLPALMKKLDGWNLSKGGKSVVLQTRAVE
QRTLTPSWQHRVLRGIANPNLAYILLMIGLAGLYFELSQPGAIFPGVIGGVSLILALYSL
QTLSVNYAGFLIILLAVIFFILEIKVASHGMLSIAGVLCLVLGSLMLFRAPGSTTALAMS
VFIPTVLTVSAFFVTVASLAFRAQISRPQIGVEAFEGLIGEAHTDLRPAGKVFVNGELWN
AEADEEILMGEQVQVVSMHNLKLKVRKISGR
Download sequence
Identical sequences A0LFG3
gi|116747913|ref|YP_844600.1| 335543.Sfum_0465 WP_011697338.1.10770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]