SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335543.Sfum_1509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335543.Sfum_1509
Domain Number 1 Region: 39-95
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000523
Family NfeD domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 335543.Sfum_1509
Sequence length 99
Comment (Syntrophobacter fumaroxidans MPOB)
Sequence
MKTLIASLLIGVLVFELAEHVILPLMWLLLKRRKVSMCDVQSMVGQTAEVKQWKGKKGKV
ELGGELWNATSHAPIVPGSRVVIEDVDGLLLKVKSEDTG
Download sequence
Identical sequences A0LIE5
gi|116748945|ref|YP_845632.1| WP_011698368.1.10770 335543.Sfum_1509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]