SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335543.Sfum_2792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335543.Sfum_2792
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-47
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 335543.Sfum_2792
Sequence length 183
Comment (Syntrophobacter fumaroxidans MPOB)
Sequence
MIEIRIHGRGGQGAVTSAELAALAAIEEGKYAQAFPSFGPERRGAPVMAFVRVSDKPIVT
REKVYEPNYVVVLDPTLLKLVNVEAGLKKGGIVIVNTAKSAADVRKETGIKAKLATVDAS
KIAMDTMRVTITNTTMLGALIKAVPDLLPLKALAGPIEHRFGGIAAKNIASCNRAFEETK
VEG
Download sequence
Identical sequences A0LM18
335543.Sfum_2792 gi|116750218|ref|YP_846905.1| WP_011699637.1.10770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]