SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 335543.Sfum_3916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335543.Sfum_3916
Domain Number 1 Region: 22-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.18e-24
Family Dual specificity phosphatase-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 335543.Sfum_3916
Sequence length 197
Comment (Syntrophobacter fumaroxidans MPOB)
Sequence
MSDRREPAAGSPGATEEVVPPLRGSYWVLPGRLLAGRCPIRHDPGDTARDLGVLIESGIR
CVIDLMDGKEVDRDGNPFPDYGDALTRVARAAGTAVTRRKIPVDHLAPEEGAIRTVLDAI
DGALAEGKPVFLHCWAGRGRTGVIVGCYLVRNGLSGREALEEIARLRGHLESEHPSPEAE
TQRKIVLTWQDTTRAAG
Download sequence
Identical sequences A0LQ83
gi|116751333|ref|YP_848020.1| 335543.Sfum_3916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]