SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 335992.SAR11_1190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  335992.SAR11_1190
Domain Number 1 Region: 427-509
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000159
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 335992.SAR11_1190
Sequence length 536
Comment (Candidatus Pelagibacter ubique HTCC1062)
Sequence
MIKTTLSSFAKSIGFNSQNYIPKEGASFSLFRIEVLSGLTVALALVPEAIAFAFVAGVAP
LSGLYAAFIVGLITAVFGGRPGMISGATGALAVVMVSLVMDHGAQYLFATVVLMGILQLL
AGVFKLGKFIRMVPQPVMLGFVNGLAIVIGISQLSQFKTLNAMGQLEWISGNTLYYSVGF
VILTMLIIWLLPKITKAVPATLAAILVTSVLVLALKIDIPSVGDLASVKGGLPIFSIPSV
PLNFETLKIIFPYAFILSAIGLIESLLTLNLVGEITNKRGGASQECLAQGFANTVTGFFG
GMGGCAMIGQSMINVKSGGRTRIAGIAAAVFLLIFILYTSNYIEMIPIAALVGVMFMVVI
GTFAWNSLKILFFVPKSDALVIVLVTVVTVLEDLAVAVIVGVIVSALVFAWKSASRIRAV
ERASVREKGAKVYEIEGPLFFSSTDSFLELFKPEQDPDVIIIDFAGSKVIDQSALKAIED
IADKYNSFGKKVKLRHLTRDCHRLLSRAGQLVVDSDDDPDYGIAVDYDVKLGIFGR
Download sequence
Identical sequences Q4FLE1
gi|71083881|ref|YP_266601.1| 335992.SAR11_1190 WP_011282206.1.73441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]