SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 336407.RBE_0369 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  336407.RBE_0369
Domain Number 1 Region: 139-186
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.00000000785
Family C-terminal UvrC-binding domain of UvrB 0.0095
Further Details:      
 
Domain Number 2 Region: 4-48
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000017
Family GIY-YIG endonuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 336407.RBE_0369
Sequence length 307
Comment (Rickettsia bellii RML369-C)
Sequence
MRGRIARMVHQVYLVEYKVTISESEAFLLETQLIKQHQPRFNILLRRDKSASYIKLRSDH
DFPTLVKCYLDNSTGNKLFGPFTSGHQIDLIITELQKIFKLRTCSDSDFAFRKRPCLEYE
IGKCFAPCTGNISKEDYAELIEQINDFLSSNIEKLLGKLALKMQALSDHSHFEKAALIRD
RINLIKLSKLRIGKQYEGIIDADVIVIRDDSRFQIKVLLYRGGQKWGEQNYSPIYNQTNT
KAEVLESFIGQFYQTRKPAKEIIINVPIQNSEPIISSLKKLYNIKTKFIVPKRGSKAQIL
RDLLTTE
Download sequence
Identical sequences Q1RJL4
336407.RBE_0369 WP_011477059.1.93565 gi|91205184|ref|YP_537539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]