SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 336407.RBE_0957 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  336407.RBE_0957
Domain Number - Region: 86-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00327
Family NfeD domain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 336407.RBE_0957
Sequence length 154
Comment (Rickettsia bellii RML369-C)
Sequence
MFMINEYLTEIWLIIGVICIIAEFFAIPNIGFLFFGFGALLNALIIYNYPLISLTNQITL
FGLISLIWFCILYYPLKKYVYSKTTTNENYSDMIGKEAEVYSDVISEENLGQVKWSGVIM
NAYLAPNEKAKSGDKVFITKVKGNILICSKHRPK
Download sequence
Identical sequences Q1RHX6
gi|91205772|ref|YP_538127.1| WP_011477619.1.48488 WP_011477619.1.88888 WP_011477619.1.93565 336407.RBE_0957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]