SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 336982.TBFG_10563 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  336982.TBFG_10563
Domain Number 1 Region: 77-288
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.9e-46
Family D-glucarate dehydratase-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 336982.TBFG_10563
Sequence length 326
Comment (Mycobacterium tuberculosis F11)
Sequence
MIPVLPPLEALLDRLYVVALPMRVRFRGITTREVALIEGPAGWGEFGAFVEYQSAQACAW
LASAIETAYCAPPPVRRDRVPINATVPAVAAAQVGEVLARFPGARTAKVKVAEPGQSLAD
DIERVNAVRELVPMVRVDANGGWGVAEAVAAAAALTADGPLEYLEQPCATVAELAELRRR
VDVPIAADESIRKAEDPLAVVRAQAADIAVLKVAPLGGISALLDIAARIAVPVVVSSALD
SAVGIAAGLTAAAALPELDHACGLGTGGLFEEDVAEPAAPVDGFLAVARTTPDPARLQAL
GAPPQRRQWWIDRVKACYSLLVPSFG
Download sequence
Identical sequences A0A045H426 A0A0H3LCL7 A0A120IVL1 A0A243QSB5 A1KG30 A5TZT3 C1AKN3 F8M2D4 I6Y839 M8CIJ3 P65426 P9WJP2 P9WJP3 R4M311
gi|449062562|ref|YP_007429645.1| gi|385997328|ref|YP_005915626.1| gi|375294765|ref|YP_005099032.1| gi|339630623|ref|YP_004722265.1| gi|494694957|ref|YP_007960460.1| Rv0553 233413.Mb0568 336982.TBFG_10563 410289.BCG_0598 419947.MRA_0560 478434.TBMG_00558 561275.JTY_0568 83331.MT0579 83332.Rv0553 gi|392430974|ref|YP_006472018.1| gi|148821754|ref|YP_001286508.1| gi|253797485|ref|YP_003030486.1| gi|392385271|ref|YP_005306900.1| gi|15607693|ref|NP_215067.1| gi|121636471|ref|YP_976694.1| gi|433625650|ref|YP_007259279.1| gi|197739329|ref|YP_002160643.1| gi|148660322|ref|YP_001281845.1| gi|383306464|ref|YP_005359275.1| NP_215067.1.84033 WP_003402923.1.100000 WP_003402923.1.100021 WP_003402923.1.100069 WP_003402923.1.10015 WP_003402923.1.100208 WP_003402923.1.100216 WP_003402923.1.10022 WP_003402923.1.100255 WP_003402923.1.100260 WP_003402923.1.100270 WP_003402923.1.100279 WP_003402923.1.100286 WP_003402923.1.100308 WP_003402923.1.100309 WP_003402923.1.100318 WP_003402923.1.100337 WP_003402923.1.100338 WP_003402923.1.10037 WP_003402923.1.100383 WP_003402923.1.100395 WP_003402923.1.100396 WP_003402923.1.1004 WP_003402923.1.100459 WP_003402923.1.100460 WP_003402923.1.100552 WP_003402923.1.100581 WP_003402923.1.100600 WP_003402923.1.100625 WP_003402923.1.10064 WP_003402923.1.100666 WP_003402923.1.100671 WP_003402923.1.100677 WP_003402923.1.100682 WP_003402923.1.100697 WP_003402923.1.100703 WP_003402923.1.100716 WP_003402923.1.100722 WP_003402923.1.100754 WP_003402923.1.100757 WP_003402923.1.100772 WP_003402923.1.1008 WP_003402923.1.100812 WP_003402923.1.100845 WP_003402923.1.100866 WP_003402923.1.10088 WP_003402923.1.100889 WP_003402923.1.10090 WP_003402923.1.100910 WP_003402923.1.100915 WP_003402923.1.100918 WP_003402923.1.100935 WP_003402923.1.100984 WP_003402923.1.100992 WP_003402923.1.100998 WP_003402923.1.101 WP_003402923.1.101025 WP_003402923.1.101028 WP_003402923.1.10104 WP_003402923.1.101048 WP_003402923.1.101054 WP_003402923.1.101075 WP_003402923.1.101143 WP_003402923.1.101146 WP_003402923.1.10117 WP_003402923.1.101209 WP_003402923.1.10125 WP_003402923.1.101290 WP_003402923.1.101323 WP_003402923.1.101324 WP_003402923.1.101350 WP_003402923.1.101367 WP_003402923.1.101398 WP_003402923.1.101403 WP_003402923.1.101421 WP_003402923.1.10144 WP_003402923.1.101442 WP_003402923.1.10145 WP_003402923.1.101452 WP_003402923.1.101456 WP_003402923.1.101481 WP_003402923.1.101493 WP_003402923.1.101496 WP_003402923.1.101525 WP_003402923.1.101533 WP_003402923.1.101535 WP_003402923.1.101553 WP_003402923.1.101558 WP_003402923.1.10156 WP_003402923.1.101573 WP_003402923.1.101576 WP_003402923.1.10159 WP_003402923.1.101592 WP_003402923.1.101604 WP_003402923.1.101607 WP_003402923.1.101622 WP_003402923.1.101644 WP_003402923.1.101659 WP_003402923.1.101671 WP_003402923.1.101687 WP_003402923.1.101698 WP_003402923.1.10170 WP_003402923.1.101713 WP_003402923.1.101722 WP_003402923.1.101733 WP_003402923.1.101743 WP_003402923.1.101753 WP_003402923.1.101754 WP_003402923.1.101764 WP_003402923.1.101773 WP_003402923.1.101795 WP_003402923.1.101797 WP_003402923.1.101798 WP_003402923.1.101802 WP_003402923.1.101826 WP_003402923.1.101836 WP_003402923.1.101858 WP_003402923.1.101859 WP_003402923.1.101862 WP_003402923.1.101888 WP_003402923.1.101894 WP_003402923.1.101899 WP_003402923.1.1019 WP_003402923.1.101923 WP_003402923.1.101925 WP_003402923.1.10193 WP_003402923.1.101996 WP_003402923.1.102 WP_003402923.1.102008 WP_003402923.1.102017 WP_003402923.1.102053 WP_003402923.1.102055 WP_003402923.1.102063 WP_003402923.1.102099 WP_003402923.1.1021 WP_003402923.1.10211 WP_003402923.1.102119 WP_003402923.1.102121 WP_003402923.1.102143 WP_003402923.1.10216 WP_003402923.1.10224 WP_003402923.1.10253 WP_003402923.1.10262 WP_003402923.1.10272 WP_003402923.1.10277 WP_003402923.1.1033 WP_003402923.1.10350 WP_003402923.1.10362 WP_003402923.1.10366 WP_003402923.1.10376 WP_003402923.1.10396 WP_003402923.1.10410 WP_003402923.1.10414 WP_003402923.1.10421 WP_003402923.1.10430 WP_003402923.1.1044 WP_003402923.1.10440 WP_003402923.1.10445 WP_003402923.1.10471 WP_003402923.1.10472 WP_003402923.1.10489 WP_003402923.1.105 WP_003402923.1.10518 WP_003402923.1.10523 WP_003402923.1.10545 WP_003402923.1.1057 WP_003402923.1.10594 WP_003402923.1.10603 WP_003402923.1.10606 WP_003402923.1.10615 WP_003402923.1.10623 WP_003402923.1.10635 WP_003402923.1.10643 WP_003402923.1.10648 WP_003402923.1.10662 WP_003402923.1.10709 WP_003402923.1.10735 WP_003402923.1.10740 WP_003402923.1.10756 WP_003402923.1.1078 WP_003402923.1.10791 WP_003402923.1.10799 WP_003402923.1.10825 WP_003402923.1.10848 WP_003402923.1.10863 WP_003402923.1.10879 WP_003402923.1.10912 WP_003402923.1.10916 WP_003402923.1.10923 WP_003402923.1.10927 WP_003402923.1.1095 WP_003402923.1.10956 WP_003402923.1.10958 WP_003402923.1.10962 WP_003402923.1.10980 WP_003402923.1.10981 WP_003402923.1.10993 WP_003402923.1.1100 WP_003402923.1.11040 WP_003402923.1.11061 WP_003402923.1.11070 WP_003402923.1.11141 WP_003402923.1.11171 WP_003402923.1.11175 WP_003402923.1.11176 WP_003402923.1.11222 WP_003402923.1.11236 WP_003402923.1.11329 WP_003402923.1.1133 WP_003402923.1.11342 WP_003402923.1.11373 WP_003402923.1.11376 WP_003402923.1.11390 WP_003402923.1.11402 WP_003402923.1.11481 WP_003402923.1.11487 WP_003402923.1.11489 WP_003402923.1.11491 WP_003402923.1.11514 WP_003402923.1.11587 WP_003402923.1.11589 WP_003402923.1.11596 WP_003402923.1.11604 WP_003402923.1.11610 WP_003402923.1.11697 WP_003402923.1.11707 WP_003402923.1.11752 WP_003402923.1.11758 WP_003402923.1.11761 WP_003402923.1.11775 WP_003402923.1.11804 WP_003402923.1.11822 WP_003402923.1.11826 WP_003402923.1.11856 WP_003402923.1.11898 WP_003402923.1.11906 WP_003402923.1.11939 WP_003402923.1.11960 WP_003402923.1.11961 WP_003402923.1.11972 WP_003402923.1.11984 WP_003402923.1.120 WP_003402923.1.12001 WP_003402923.1.12049 WP_003402923.1.12052 WP_003402923.1.12100 WP_003402923.1.12116 WP_003402923.1.12130 WP_003402923.1.12133 WP_003402923.1.12161 WP_003402923.1.12165 WP_003402923.1.12184 WP_003402923.1.12187 WP_003402923.1.12190 WP_003402923.1.12216 WP_003402923.1.12265 WP_003402923.1.12275 WP_003402923.1.12293 WP_003402923.1.12294 WP_003402923.1.123 WP_003402923.1.1231 WP_003402923.1.12314 WP_003402923.1.12327 WP_003402923.1.12338 WP_003402923.1.1236 WP_003402923.1.12371 WP_003402923.1.12372 WP_003402923.1.12389 WP_003402923.1.12406 WP_003402923.1.1241 WP_003402923.1.12421 WP_003402923.1.12424 WP_003402923.1.12446 WP_003402923.1.12464 WP_003402923.1.12479 WP_003402923.1.12519 WP_003402923.1.12523 WP_003402923.1.12526 WP_003402923.1.1255 WP_003402923.1.12550 WP_003402923.1.12551 WP_003402923.1.12563 WP_003402923.1.12611 WP_003402923.1.12669 WP_003402923.1.1267 WP_003402923.1.12672 WP_003402923.1.12692 WP_003402923.1.1271 WP_003402923.1.12710 WP_003402923.1.12768 WP_003402923.1.1279 WP_003402923.1.12801 WP_003402923.1.12804 WP_003402923.1.12821 WP_003402923.1.12841 WP_003402923.1.12854 WP_003402923.1.12871 WP_003402923.1.12901 WP_003402923.1.12941 WP_003402923.1.12947 WP_003402923.1.12957 WP_003402923.1.12972 WP_003402923.1.13028 WP_003402923.1.13043 WP_003402923.1.13086 WP_003402923.1.13087 WP_003402923.1.13090 WP_003402923.1.13096 WP_003402923.1.13163 WP_003402923.1.13175 WP_003402923.1.13183 WP_003402923.1.132 WP_003402923.1.13249 WP_003402923.1.13282 WP_003402923.1.13284 WP_003402923.1.13296 WP_003402923.1.13298 WP_003402923.1.13302 WP_003402923.1.13306 WP_003402923.1.13312 WP_003402923.1.13313 WP_003402923.1.13345 WP_003402923.1.13358 WP_003402923.1.13370 WP_003402923.1.13375 WP_003402923.1.1338 WP_003402923.1.13420 WP_003402923.1.13433 WP_003402923.1.13435 WP_003402923.1.13438 WP_003402923.1.13461 WP_003402923.1.13466 WP_003402923.1.13489 WP_003402923.1.13526 WP_003402923.1.13551 WP_003402923.1.13561 WP_003402923.1.13564 WP_003402923.1.13579 WP_003402923.1.13647 WP_003402923.1.13667 WP_003402923.1.13687 WP_003402923.1.13697 WP_003402923.1.13719 WP_003402923.1.13763 WP_003402923.1.1377 WP_003402923.1.13774 WP_003402923.1.13786 WP_003402923.1.13793 WP_003402923.1.13794 WP_003402923.1.13817 WP_003402923.1.13834 WP_003402923.1.13866 WP_003402923.1.13880 WP_003402923.1.13899 WP_003402923.1.13909 WP_003402923.1.13910 WP_003402923.1.13919 WP_003402923.1.13920 WP_003402923.1.13952 WP_003402923.1.13953 WP_003402923.1.13962 WP_003402923.1.1398 WP_003402923.1.13988 WP_003402923.1.14027 WP_003402923.1.14046 WP_003402923.1.14115 WP_003402923.1.1415 WP_003402923.1.14152 WP_003402923.1.14158 WP_003402923.1.14162 WP_003402923.1.14175 WP_003402923.1.14178 WP_003402923.1.14194 WP_003402923.1.14195 WP_003402923.1.14208 WP_003402923.1.14238 WP_003402923.1.14266 WP_003402923.1.14273 WP_003402923.1.14303 WP_003402923.1.14306 WP_003402923.1.14307 WP_003402923.1.14310 WP_003402923.1.14341 WP_003402923.1.14382 WP_003402923.1.14416 WP_003402923.1.14428 WP_003402923.1.14441 WP_003402923.1.14477 WP_003402923.1.14504 WP_003402923.1.14514 WP_003402923.1.1452 WP_003402923.1.14527 WP_003402923.1.1454 WP_003402923.1.14544 WP_003402923.1.14548 WP_003402923.1.14551 WP_003402923.1.14561 WP_003402923.1.14573 WP_003402923.1.1462 WP_003402923.1.14658 WP_003402923.1.14667 WP_003402923.1.14668 WP_003402923.1.14675 WP_003402923.1.14694 WP_003402923.1.14695 WP_003402923.1.14709 WP_003402923.1.14766 WP_003402923.1.14783 WP_003402923.1.14865 WP_003402923.1.14872 WP_003402923.1.14905 WP_003402923.1.14926 WP_003402923.1.14951 WP_003402923.1.14955 WP_003402923.1.15003 WP_003402923.1.15009 WP_003402923.1.15028 WP_003402923.1.15040 WP_003402923.1.15052 WP_003402923.1.15065 WP_003402923.1.15072 WP_003402923.1.15089 WP_003402923.1.1509 WP_003402923.1.15126 WP_003402923.1.15131 WP_003402923.1.15168 WP_003402923.1.15172 WP_003402923.1.15174 WP_003402923.1.15187 WP_003402923.1.15196 WP_003402923.1.15210 WP_003402923.1.15216 WP_003402923.1.15217 WP_003402923.1.1523 WP_003402923.1.15232 WP_003402923.1.15238 WP_003402923.1.15240 WP_003402923.1.15253 WP_003402923.1.15267 WP_003402923.1.1527 WP_003402923.1.15292 WP_003402923.1.15299 WP_003402923.1.15302 WP_003402923.1.15322 WP_003402923.1.1534 WP_003402923.1.15345 WP_003402923.1.15365 WP_003402923.1.15386 WP_003402923.1.15387 WP_003402923.1.15442 WP_003402923.1.15447 WP_003402923.1.15449 WP_003402923.1.15477 WP_003402923.1.15481 WP_003402923.1.15492 WP_003402923.1.15511 WP_003402923.1.15512 WP_003402923.1.15558 WP_003402923.1.15559 WP_003402923.1.15566 WP_003402923.1.15599 WP_003402923.1.1560 WP_003402923.1.15611 WP_003402923.1.1563 WP_003402923.1.15633 WP_003402923.1.15643 WP_003402923.1.15688 WP_003402923.1.15755 WP_003402923.1.15763 WP_003402923.1.15774 WP_003402923.1.1578 WP_003402923.1.15780 WP_003402923.1.15827 WP_003402923.1.15834 WP_003402923.1.15842 WP_003402923.1.15848 WP_003402923.1.15853 WP_003402923.1.15870 WP_003402923.1.15877 WP_003402923.1.15893 WP_003402923.1.15896 WP_003402923.1.15926 WP_003402923.1.15933 WP_003402923.1.15946 WP_003402923.1.15958 WP_003402923.1.15973 WP_003402923.1.15987 WP_003402923.1.15993 WP_003402923.1.16009 WP_003402923.1.16025 WP_003402923.1.16043 WP_003402923.1.16055 WP_003402923.1.16066 WP_003402923.1.16069 WP_003402923.1.16077 WP_003402923.1.16106 WP_003402923.1.16108 WP_003402923.1.16110 WP_003402923.1.16130 WP_003402923.1.16136 WP_003402923.1.16139 WP_003402923.1.16141 WP_003402923.1.16143 WP_003402923.1.1630 WP_003402923.1.16318 WP_003402923.1.1632 WP_003402923.1.16327 WP_003402923.1.16334 WP_003402923.1.16341 WP_003402923.1.16345 WP_003402923.1.16374 WP_003402923.1.16384 WP_003402923.1.16386 WP_003402923.1.164 WP_003402923.1.1642 WP_003402923.1.16421 WP_003402923.1.16424 WP_003402923.1.16426 WP_003402923.1.16431 WP_003402923.1.16438 WP_003402923.1.16442 WP_003402923.1.16448 WP_003402923.1.16451 WP_003402923.1.16476 WP_003402923.1.16480 WP_003402923.1.16494 WP_003402923.1.1652 WP_003402923.1.16549 WP_003402923.1.16560 WP_003402923.1.16598 WP_003402923.1.16609 WP_003402923.1.16619 WP_003402923.1.16620 WP_003402923.1.16622 WP_003402923.1.16637 WP_003402923.1.1669 WP_003402923.1.16707 WP_003402923.1.16724 WP_003402923.1.16731 WP_003402923.1.16743 WP_003402923.1.1683 WP_003402923.1.16852 WP_003402923.1.16937 WP_003402923.1.16940 WP_003402923.1.16950 WP_003402923.1.16959 WP_003402923.1.16968 WP_003402923.1.1697 WP_003402923.1.16973 WP_003402923.1.16977 WP_003402923.1.16987 WP_003402923.1.17005 WP_003402923.1.17006 WP_003402923.1.17010 WP_003402923.1.17015 WP_003402923.1.17019 WP_003402923.1.17039 WP_003402923.1.17041 WP_003402923.1.17052 WP_003402923.1.17057 WP_003402923.1.17062 WP_003402923.1.1707 WP_003402923.1.17094 WP_003402923.1.17130 WP_003402923.1.17138 WP_003402923.1.17147 WP_003402923.1.17224 WP_003402923.1.17251 WP_003402923.1.17288 WP_003402923.1.17304 WP_003402923.1.17314 WP_003402923.1.17345 WP_003402923.1.17381 WP_003402923.1.17391 WP_003402923.1.17412 WP_003402923.1.1743 WP_003402923.1.17440 WP_003402923.1.17466 WP_003402923.1.17477 WP_003402923.1.17483 WP_003402923.1.17505 WP_003402923.1.17527 WP_003402923.1.17535 WP_003402923.1.17540 WP_003402923.1.17553 WP_003402923.1.17558 WP_003402923.1.17599 WP_003402923.1.17635 WP_003402923.1.17655 WP_003402923.1.17679 WP_003402923.1.1768 WP_003402923.1.17687 WP_003402923.1.17700 WP_003402923.1.17710 WP_003402923.1.17713 WP_003402923.1.17722 WP_003402923.1.17746 WP_003402923.1.17788 WP_003402923.1.17798 WP_003402923.1.17803 WP_003402923.1.17816 WP_003402923.1.17821 WP_003402923.1.17830 WP_003402923.1.17868 WP_003402923.1.17878 WP_003402923.1.1792 WP_003402923.1.17923 WP_003402923.1.1795 WP_003402923.1.17955 WP_003402923.1.17973 WP_003402923.1.18009 WP_003402923.1.18013 WP_003402923.1.18033 WP_003402923.1.18057 WP_003402923.1.18065 WP_003402923.1.18070 WP_003402923.1.18116 WP_003402923.1.18120 WP_003402923.1.18126 WP_003402923.1.1817 WP_003402923.1.18170 WP_003402923.1.18206 WP_003402923.1.18216 WP_003402923.1.18240 WP_003402923.1.18257 WP_003402923.1.18297 WP_003402923.1.18306 WP_003402923.1.18364 WP_003402923.1.18399 WP_003402923.1.18411 WP_003402923.1.18444 WP_003402923.1.18448 WP_003402923.1.18467 WP_003402923.1.18476 WP_003402923.1.18522 WP_003402923.1.18580 WP_003402923.1.18582 WP_003402923.1.18587 WP_003402923.1.186 WP_003402923.1.18601 WP_003402923.1.18639 WP_003402923.1.18646 WP_003402923.1.18647 WP_003402923.1.1868 WP_003402923.1.18694 WP_003402923.1.18710 WP_003402923.1.18751 WP_003402923.1.18781 WP_003402923.1.18793 WP_003402923.1.18804 WP_003402923.1.18816 WP_003402923.1.18823 WP_003402923.1.18827 WP_003402923.1.18849 WP_003402923.1.18856 WP_003402923.1.18945 WP_003402923.1.1898 WP_003402923.1.19005 WP_003402923.1.19056 WP_003402923.1.19063 WP_003402923.1.19066 WP_003402923.1.19071 WP_003402923.1.19085 WP_003402923.1.19094 WP_003402923.1.19144 WP_003402923.1.19159 WP_003402923.1.19193 WP_003402923.1.19231 WP_003402923.1.19243 WP_003402923.1.19264 WP_003402923.1.19295 WP_003402923.1.19307 WP_003402923.1.19326 WP_003402923.1.1933 WP_003402923.1.19364 WP_003402923.1.19382 WP_003402923.1.19400 WP_003402923.1.19426 WP_003402923.1.19429 WP_003402923.1.19480 WP_003402923.1.19512 WP_003402923.1.19562 WP_003402923.1.19564 WP_003402923.1.19568 WP_003402923.1.19572 WP_003402923.1.19595 WP_003402923.1.19596 WP_003402923.1.19630 WP_003402923.1.1967 WP_003402923.1.19694 WP_003402923.1.1970 WP_003402923.1.19707 WP_003402923.1.19742 WP_003402923.1.19785 WP_003402923.1.19820 WP_003402923.1.19868 WP_003402923.1.19874 WP_003402923.1.19890 WP_003402923.1.19900 WP_003402923.1.19922 WP_003402923.1.19936 WP_003402923.1.19946 WP_003402923.1.19949 WP_003402923.1.19960 WP_003402923.1.19964 WP_003402923.1.20007 WP_003402923.1.20016 WP_003402923.1.20028 WP_003402923.1.2003 WP_003402923.1.20037 WP_003402923.1.20039 WP_003402923.1.20082 WP_003402923.1.20085 WP_003402923.1.20097 WP_003402923.1.20116 WP_003402923.1.20130 WP_003402923.1.20140 WP_003402923.1.20141 WP_003402923.1.20142 WP_003402923.1.20158 WP_003402923.1.20239 WP_003402923.1.20243 WP_003402923.1.20259 WP_003402923.1.20262 WP_003402923.1.20268 WP_003402923.1.20272 WP_003402923.1.20273 WP_003402923.1.20280 WP_003402923.1.20294 WP_003402923.1.20300 WP_003402923.1.20309 WP_003402923.1.20322 WP_003402923.1.2037 WP_003402923.1.20372 WP_003402923.1.20381 WP_003402923.1.204 WP_003402923.1.20427 WP_003402923.1.20432 WP_003402923.1.20457 WP_003402923.1.20459 WP_003402923.1.20460 WP_003402923.1.20542 WP_003402923.1.20578 WP_003402923.1.20608 WP_003402923.1.20624 WP_003402923.1.20628 WP_003402923.1.2066 WP_003402923.1.20707 WP_003402923.1.20722 WP_003402923.1.20729 WP_003402923.1.20742 WP_003402923.1.20751 WP_003402923.1.20776 WP_003402923.1.20843 WP_003402923.1.20850 WP_003402923.1.2086 WP_003402923.1.20868 WP_003402923.1.20876 WP_003402923.1.20897 WP_003402923.1.20898 WP_003402923.1.2090 WP_003402923.1.20911 WP_003402923.1.20916 WP_003402923.1.20921 WP_003402923.1.20926 WP_003402923.1.20927 WP_003402923.1.20951 WP_003402923.1.20970 WP_003402923.1.2104 WP_003402923.1.21070 WP_003402923.1.21127 WP_003402923.1.21135 WP_003402923.1.21173 WP_003402923.1.21187 WP_003402923.1.212 WP_003402923.1.2120 WP_003402923.1.21218 WP_003402923.1.21219 WP_003402923.1.2123 WP_003402923.1.21231 WP_003402923.1.21234 WP_003402923.1.2126 WP_003402923.1.21292 WP_003402923.1.21307 WP_003402923.1.2131 WP_003402923.1.21311 WP_003402923.1.21321 WP_003402923.1.21365 WP_003402923.1.2137 WP_003402923.1.21392 WP_003402923.1.21397 WP_003402923.1.21415 WP_003402923.1.21430 WP_003402923.1.21434 WP_003402923.1.21444 WP_003402923.1.21468 WP_003402923.1.21498 WP_003402923.1.21509 WP_003402923.1.21513 WP_003402923.1.21560 WP_003402923.1.21565 WP_003402923.1.21586 WP_003402923.1.21591 WP_003402923.1.21594 WP_003402923.1.21602 WP_003402923.1.21615 WP_003402923.1.21638 WP_003402923.1.21639 WP_003402923.1.21655 WP_003402923.1.21658 WP_003402923.1.2168 WP_003402923.1.2174 WP_003402923.1.21741 WP_003402923.1.21742 WP_003402923.1.21777 WP_003402923.1.21786 WP_003402923.1.21795 WP_003402923.1.218 WP_003402923.1.21826 WP_003402923.1.21829 WP_003402923.1.21840 WP_003402923.1.21843 WP_003402923.1.21872 WP_003402923.1.21873 WP_003402923.1.2188 WP_003402923.1.21882 WP_003402923.1.21906 WP_003402923.1.21912 WP_003402923.1.2194 WP_003402923.1.21941 WP_003402923.1.21956 WP_003402923.1.21958 WP_003402923.1.21960 WP_003402923.1.21971 WP_003402923.1.21973 WP_003402923.1.21983 WP_003402923.1.22003 WP_003402923.1.22013 WP_003402923.1.22025 WP_003402923.1.22036 WP_003402923.1.22075 WP_003402923.1.22092 WP_003402923.1.2212 WP_003402923.1.22127 WP_003402923.1.22140 WP_003402923.1.22233 WP_003402923.1.22255 WP_003402923.1.22277 WP_003402923.1.22305 WP_003402923.1.22348 WP_003402923.1.22356 WP_003402923.1.22366 WP_003402923.1.2238 WP_003402923.1.22380 WP_003402923.1.22437 WP_003402923.1.22438 WP_003402923.1.22445 WP_003402923.1.22490 WP_003402923.1.22511 WP_003402923.1.22524 WP_003402923.1.2253 WP_003402923.1.22585 WP_003402923.1.22589 WP_003402923.1.22606 WP_003402923.1.22608 WP_003402923.1.22609 WP_003402923.1.22618 WP_003402923.1.2262 WP_003402923.1.22624 WP_003402923.1.22629 WP_003402923.1.22647 WP_003402923.1.22664 WP_003402923.1.22665 WP_003402923.1.22670 WP_003402923.1.22674 WP_003402923.1.22680 WP_003402923.1.22725 WP_003402923.1.22728 WP_003402923.1.22733 WP_003402923.1.22737 WP_003402923.1.22754 WP_003402923.1.22797 WP_003402923.1.22800 WP_003402923.1.22804 WP_003402923.1.22829 WP_003402923.1.22840 WP_003402923.1.22844 WP_003402923.1.22963 WP_003402923.1.22970 WP_003402923.1.22996 WP_003402923.1.22997 WP_003402923.1.22999 WP_003402923.1.23015 WP_003402923.1.23032 WP_003402923.1.231 WP_003402923.1.23101 WP_003402923.1.2312 WP_003402923.1.23140 WP_003402923.1.23153 WP_003402923.1.23171 WP_003402923.1.23199 WP_003402923.1.2320 WP_003402923.1.23204 WP_003402923.1.23216 WP_003402923.1.23229 WP_003402923.1.23233 WP_003402923.1.2326 WP_003402923.1.23261 WP_003402923.1.23272 WP_003402923.1.23289 WP_003402923.1.2329 WP_003402923.1.23308 WP_003402923.1.23316 WP_003402923.1.23321 WP_003402923.1.2339 WP_003402923.1.23406 WP_003402923.1.23438 WP_003402923.1.23445 WP_003402923.1.23447 WP_003402923.1.23452 WP_003402923.1.23461 WP_003402923.1.2349 WP_003402923.1.23496 WP_003402923.1.23497 WP_003402923.1.23506 WP_003402923.1.23530 WP_003402923.1.23539 WP_003402923.1.23546 WP_003402923.1.23551 WP_003402923.1.23573 WP_003402923.1.23583 WP_003402923.1.23588 WP_003402923.1.23628 WP_003402923.1.23677 WP_003402923.1.23683 WP_003402923.1.23692 WP_003402923.1.23694 WP_003402923.1.23699 WP_003402923.1.2371 WP_003402923.1.23803 WP_003402923.1.23807 WP_003402923.1.23825 WP_003402923.1.23832 WP_003402923.1.2384 WP_003402923.1.23843 WP_003402923.1.23863 WP_003402923.1.2387 WP_003402923.1.23894 WP_003402923.1.23993 WP_003402923.1.2400 WP_003402923.1.24007 WP_003402923.1.24008 WP_003402923.1.24046 WP_003402923.1.24057 WP_003402923.1.24062 WP_003402923.1.24113 WP_003402923.1.24128 WP_003402923.1.24140 WP_003402923.1.24176 WP_003402923.1.24190 WP_003402923.1.24202 WP_003402923.1.24244 WP_003402923.1.24261 WP_003402923.1.24284 WP_003402923.1.24294 WP_003402923.1.24357 WP_003402923.1.24396 WP_003402923.1.24414 WP_003402923.1.24423 WP_003402923.1.2443 WP_003402923.1.24446 WP_003402923.1.24461 WP_003402923.1.24500 WP_003402923.1.24507 WP_003402923.1.24509 WP_003402923.1.24529 WP_003402923.1.24553 WP_003402923.1.24629 WP_003402923.1.24638 WP_003402923.1.24648 WP_003402923.1.2466 WP_003402923.1.24767 WP_003402923.1.24824 WP_003402923.1.24831 WP_003402923.1.24840 WP_003402923.1.24848 WP_003402923.1.24857 WP_003402923.1.2487 WP_003402923.1.24893 WP_003402923.1.24907 WP_003402923.1.24933 WP_003402923.1.24956 WP_003402923.1.24958 WP_003402923.1.24985 WP_003402923.1.2499 WP_003402923.1.25004 WP_003402923.1.2505 WP_003402923.1.25051 WP_003402923.1.2507 WP_003402923.1.25096 WP_003402923.1.25129 WP_003402923.1.25171 WP_003402923.1.25184 WP_003402923.1.25247 WP_003402923.1.25252 WP_003402923.1.25278 WP_003402923.1.25283 WP_003402923.1.25309 WP_003402923.1.25313 WP_003402923.1.25338 WP_003402923.1.25342 WP_003402923.1.25343 WP_003402923.1.25367 WP_003402923.1.25393 WP_003402923.1.25406 WP_003402923.1.25435 WP_003402923.1.25437 WP_003402923.1.25445 WP_003402923.1.25455 WP_003402923.1.25473 WP_003402923.1.25504 WP_003402923.1.25513 WP_003402923.1.25542 WP_003402923.1.25579 WP_003402923.1.25594 WP_003402923.1.25606 WP_003402923.1.25645 WP_003402923.1.2566 WP_003402923.1.25673 WP_003402923.1.25674 WP_003402923.1.25693 WP_003402923.1.25699 WP_003402923.1.25727 WP_003402923.1.25736 WP_003402923.1.25738 WP_003402923.1.25756 WP_003402923.1.25759 WP_003402923.1.2580 WP_003402923.1.25813 WP_003402923.1.25853 WP_003402923.1.25854 WP_003402923.1.25874 WP_003402923.1.25885 WP_003402923.1.25892 WP_003402923.1.25906 WP_003402923.1.25914 WP_003402923.1.25916 WP_003402923.1.2594 WP_003402923.1.25954 WP_003402923.1.25965 WP_003402923.1.25972 WP_003402923.1.26017 WP_003402923.1.26038 WP_003402923.1.26072 WP_003402923.1.26089 WP_003402923.1.26097 WP_003402923.1.26098 WP_003402923.1.26108 WP_003402923.1.26109 WP_003402923.1.26118 WP_003402923.1.26126 WP_003402923.1.2614 WP_003402923.1.26168 WP_003402923.1.26182 WP_003402923.1.26190 WP_003402923.1.2620 WP_003402923.1.26234 WP_003402923.1.26243 WP_003402923.1.26265 WP_003402923.1.26267 WP_003402923.1.26292 WP_003402923.1.26310 WP_003402923.1.26328 WP_003402923.1.26349 WP_003402923.1.26366 WP_003402923.1.26374 WP_003402923.1.26407 WP_003402923.1.26412 WP_003402923.1.26454 WP_003402923.1.26464 WP_003402923.1.2653 WP_003402923.1.26560 WP_003402923.1.26571 WP_003402923.1.2659 WP_003402923.1.26597 WP_003402923.1.26603 WP_003402923.1.26629 WP_003402923.1.26651 WP_003402923.1.26702 WP_003402923.1.26707 WP_003402923.1.26710 WP_003402923.1.26719 WP_003402923.1.26737 WP_003402923.1.26738 WP_003402923.1.26745 WP_003402923.1.26756 WP_003402923.1.2676 WP_003402923.1.2677 WP_003402923.1.26779 WP_003402923.1.26780 WP_003402923.1.26798 WP_003402923.1.26854 WP_003402923.1.26868 WP_003402923.1.26876 WP_003402923.1.26888 WP_003402923.1.26914 WP_003402923.1.26945 WP_003402923.1.26959 WP_003402923.1.26969 WP_003402923.1.26984 WP_003402923.1.26992 WP_003402923.1.27004 WP_003402923.1.27017 WP_003402923.1.27045 WP_003402923.1.27074 WP_003402923.1.27075 WP_003402923.1.27128 WP_003402923.1.27130 WP_003402923.1.27139 WP_003402923.1.27152 WP_003402923.1.27162 WP_003402923.1.27164 WP_003402923.1.27193 WP_003402923.1.27235 WP_003402923.1.27254 WP_003402923.1.27278 WP_003402923.1.27343 WP_003402923.1.27352 WP_003402923.1.27369 WP_003402923.1.27391 WP_003402923.1.27398 WP_003402923.1.27402 WP_003402923.1.27410 WP_003402923.1.27411 WP_003402923.1.27449 WP_003402923.1.27460 WP_003402923.1.27463 WP_003402923.1.2749 WP_003402923.1.27492 WP_003402923.1.27528 WP_003402923.1.27541 WP_003402923.1.27576 WP_003402923.1.27582 WP_003402923.1.27596 WP_003402923.1.27607 WP_003402923.1.2766 WP_003402923.1.277 WP_003402923.1.27724 WP_003402923.1.27730 WP_003402923.1.27736 WP_003402923.1.27743 WP_003402923.1.27750 WP_003402923.1.27771 WP_003402923.1.27779 WP_003402923.1.27795 WP_003402923.1.27803 WP_003402923.1.27819 WP_003402923.1.27915 WP_003402923.1.27935 WP_003402923.1.27962 WP_003402923.1.28053 WP_003402923.1.28092 WP_003402923.1.28106 WP_003402923.1.28131 WP_003402923.1.28142 WP_003402923.1.28159 WP_003402923.1.2816 WP_003402923.1.28161 WP_003402923.1.28192 WP_003402923.1.28202 WP_003402923.1.28241 WP_003402923.1.28251 WP_003402923.1.28255 WP_003402923.1.28269 WP_003402923.1.28276 WP_003402923.1.28293 WP_003402923.1.28331 WP_003402923.1.28367 WP_003402923.1.28378 WP_003402923.1.28391 WP_003402923.1.2842 WP_003402923.1.28448 WP_003402923.1.2847 WP_003402923.1.28471 WP_003402923.1.28493 WP_003402923.1.28497 WP_003402923.1.28530 WP_003402923.1.28545 WP_003402923.1.28561 WP_003402923.1.28567 WP_003402923.1.28585 WP_003402923.1.286 WP_003402923.1.28617 WP_003402923.1.28634 WP_003402923.1.28642 WP_003402923.1.28671 WP_003402923.1.28682 WP_003402923.1.28698 WP_003402923.1.28703 WP_003402923.1.28739 WP_003402923.1.28758 WP_003402923.1.28781 WP_003402923.1.28787 WP_003402923.1.28827 WP_003402923.1.28839 WP_003402923.1.28847 WP_003402923.1.28850 WP_003402923.1.28851 WP_003402923.1.28865 WP_003402923.1.28897 WP_003402923.1.28914 WP_003402923.1.28935 WP_003402923.1.28936 WP_003402923.1.28939 WP_003402923.1.28943 WP_003402923.1.28952 WP_003402923.1.28975 WP_003402923.1.2899 WP_003402923.1.28993 WP_003402923.1.29000 WP_003402923.1.2901 WP_003402923.1.29028 WP_003402923.1.29033 WP_003402923.1.29058 WP_003402923.1.29078 WP_003402923.1.29102 WP_003402923.1.29115 WP_003402923.1.2916 WP_003402923.1.29217 WP_003402923.1.29223 WP_003402923.1.29234 WP_003402923.1.29264 WP_003402923.1.29275 WP_003402923.1.29306 WP_003402923.1.29339 WP_003402923.1.29348 WP_003402923.1.29364 WP_003402923.1.29367 WP_003402923.1.2938 WP_003402923.1.29399 WP_003402923.1.2944 WP_003402923.1.29449 WP_003402923.1.29450 WP_003402923.1.29452 WP_003402923.1.29510 WP_003402923.1.29515 WP_003402923.1.29525 WP_003402923.1.2953 WP_003402923.1.29559 WP_003402923.1.29587 WP_003402923.1.2959 WP_003402923.1.29592 WP_003402923.1.29599 WP_003402923.1.29611 WP_003402923.1.29632 WP_003402923.1.29649 WP_003402923.1.2965 WP_003402923.1.29659 WP_003402923.1.2969 WP_003402923.1.29696 WP_003402923.1.29698 WP_003402923.1.29718 WP_003402923.1.29742 WP_003402923.1.29745 WP_003402923.1.29747 WP_003402923.1.29769 WP_003402923.1.29825 WP_003402923.1.29830 WP_003402923.1.29847 WP_003402923.1.29861 WP_003402923.1.29869 WP_003402923.1.29883 WP_003402923.1.29890 WP_003402923.1.29931 WP_003402923.1.29960 WP_003402923.1.30014 WP_003402923.1.3004 WP_003402923.1.30040 WP_003402923.1.30043 WP_003402923.1.30074 WP_003402923.1.30097 WP_003402923.1.30106 WP_003402923.1.30114 WP_003402923.1.30126 WP_003402923.1.30131 WP_003402923.1.30138 WP_003402923.1.30139 WP_003402923.1.30145 WP_003402923.1.30211 WP_003402923.1.30224 WP_003402923.1.30235 WP_003402923.1.30237 WP_003402923.1.3027 WP_003402923.1.30279 WP_003402923.1.30282 WP_003402923.1.30288 WP_003402923.1.30291 WP_003402923.1.30363 WP_003402923.1.30374 WP_003402923.1.30404 WP_003402923.1.3043 WP_003402923.1.30433 WP_003402923.1.30438 WP_003402923.1.30462 WP_003402923.1.30464 WP_003402923.1.30468 WP_003402923.1.30500 WP_003402923.1.3057 WP_003402923.1.30574 WP_003402923.1.30628 WP_003402923.1.30641 WP_003402923.1.30642 WP_003402923.1.30661 WP_003402923.1.30669 WP_003402923.1.30683 WP_003402923.1.30699 WP_003402923.1.30709 WP_003402923.1.30713 WP_003402923.1.30716 WP_003402923.1.30719 WP_003402923.1.30730 WP_003402923.1.30732 WP_003402923.1.30736 WP_003402923.1.30745 WP_003402923.1.30760 WP_003402923.1.30791 WP_003402923.1.308 WP_003402923.1.30807 WP_003402923.1.30818 WP_003402923.1.30824 WP_003402923.1.30848 WP_003402923.1.30877 WP_003402923.1.30888 WP_003402923.1.30901 WP_003402923.1.30903 WP_003402923.1.30912 WP_003402923.1.30913 WP_003402923.1.30914 WP_003402923.1.30919 WP_003402923.1.30977 WP_003402923.1.3100 WP_003402923.1.31002 WP_003402923.1.3101 WP_003402923.1.31034 WP_003402923.1.31047 WP_003402923.1.31070 WP_003402923.1.31074 WP_003402923.1.31102 WP_003402923.1.31127 WP_003402923.1.31184 WP_003402923.1.31199 WP_003402923.1.31226 WP_003402923.1.31230 WP_003402923.1.31233 WP_003402923.1.31263 WP_003402923.1.31264 WP_003402923.1.31270 WP_003402923.1.31287 WP_003402923.1.31290 WP_003402923.1.31304 WP_003402923.1.31346 WP_003402923.1.31348 WP_003402923.1.31354 WP_003402923.1.31390 WP_003402923.1.31414 WP_003402923.1.31417 WP_003402923.1.31428 WP_003402923.1.3143 WP_003402923.1.31458 WP_003402923.1.31483 WP_003402923.1.3149 WP_003402923.1.31498 WP_003402923.1.31507 WP_003402923.1.31537 WP_003402923.1.31548 WP_003402923.1.31569 WP_003402923.1.31573 WP_003402923.1.316 WP_003402923.1.31629 WP_003402923.1.31666 WP_003402923.1.31693 WP_003402923.1.31703 WP_003402923.1.31744 WP_003402923.1.31770 WP_003402923.1.31776 WP_003402923.1.31783 WP_003402923.1.318 WP_003402923.1.3184 WP_003402923.1.31840 WP_003402923.1.31880 WP_003402923.1.31911 WP_003402923.1.31930 WP_003402923.1.31932 WP_003402923.1.31955 WP_003402923.1.31985 WP_003402923.1.31991 WP_003402923.1.31995 WP_003402923.1.32004 WP_003402923.1.32039 WP_003402923.1.3204 WP_003402923.1.32045 WP_003402923.1.32071 WP_003402923.1.32098 WP_003402923.1.32132 WP_003402923.1.32157 WP_003402923.1.32164 WP_003402923.1.32179 WP_003402923.1.32198 WP_003402923.1.32297 WP_003402923.1.32317 WP_003402923.1.32383 WP_003402923.1.32400 WP_003402923.1.32403 WP_003402923.1.32416 WP_003402923.1.32421 WP_003402923.1.32433 WP_003402923.1.32461 WP_003402923.1.32482 WP_003402923.1.32503 WP_003402923.1.32556 WP_003402923.1.32562 WP_003402923.1.32569 WP_003402923.1.32592 WP_003402923.1.32620 WP_003402923.1.32647 WP_003402923.1.32653 WP_003402923.1.32654 WP_003402923.1.3268 WP_003402923.1.32695 WP_003402923.1.32706 WP_003402923.1.32716 WP_003402923.1.32738 WP_003402923.1.32752 WP_003402923.1.32780 WP_003402923.1.32781 WP_003402923.1.32793 WP_003402923.1.32799 WP_003402923.1.32822 WP_003402923.1.32833 WP_003402923.1.32862 WP_003402923.1.32880 WP_003402923.1.32897 WP_003402923.1.32909 WP_003402923.1.32935 WP_003402923.1.32974 WP_003402923.1.33007 WP_003402923.1.3302 WP_003402923.1.33028 WP_003402923.1.33035 WP_003402923.1.33044 WP_003402923.1.33054 WP_003402923.1.33082 WP_003402923.1.33141 WP_003402923.1.33148 WP_003402923.1.33155 WP_003402923.1.33168 WP_003402923.1.3321 WP_003402923.1.33215 WP_003402923.1.3325 WP_003402923.1.3327 WP_003402923.1.33278 WP_003402923.1.33305 WP_003402923.1.3331 WP_003402923.1.33319 WP_003402923.1.3333 WP_003402923.1.33393 WP_003402923.1.33403 WP_003402923.1.33452 WP_003402923.1.33467 WP_003402923.1.33477 WP_003402923.1.3349 WP_003402923.1.33519 WP_003402923.1.33542 WP_003402923.1.33601 WP_003402923.1.33602 WP_003402923.1.33633 WP_003402923.1.33646 WP_003402923.1.33673 WP_003402923.1.3369 WP_003402923.1.33705 WP_003402923.1.33762 WP_003402923.1.33783 WP_003402923.1.33789 WP_003402923.1.3383 WP_003402923.1.33832 WP_003402923.1.33839 WP_003402923.1.33848 WP_003402923.1.3387 WP_003402923.1.33886 WP_003402923.1.33895 WP_003402923.1.33906 WP_003402923.1.33912 WP_003402923.1.33954 WP_003402923.1.3399 WP_003402923.1.34042 WP_003402923.1.3405 WP_003402923.1.34055 WP_003402923.1.34056 WP_003402923.1.34065 WP_003402923.1.3408 WP_003402923.1.34090 WP_003402923.1.34109 WP_003402923.1.34111 WP_003402923.1.34131 WP_003402923.1.34152 WP_003402923.1.34153 WP_003402923.1.34163 WP_003402923.1.34181 WP_003402923.1.34197 WP_003402923.1.34198 WP_003402923.1.34215 WP_003402923.1.34219 WP_003402923.1.34255 WP_003402923.1.34260 WP_003402923.1.34275 WP_003402923.1.343 WP_003402923.1.34347 WP_003402923.1.34358 WP_003402923.1.34392 WP_003402923.1.344 WP_003402923.1.34428 WP_003402923.1.3443 WP_003402923.1.34435 WP_003402923.1.34446 WP_003402923.1.34499 WP_003402923.1.34505 WP_003402923.1.34516 WP_003402923.1.34529 WP_003402923.1.34551 WP_003402923.1.34563 WP_003402923.1.34576 WP_003402923.1.34581 WP_003402923.1.34588 WP_003402923.1.34596 WP_003402923.1.34599 WP_003402923.1.34639 WP_003402923.1.34673 WP_003402923.1.34724 WP_003402923.1.34740 WP_003402923.1.34755 WP_003402923.1.34777 WP_003402923.1.34783 WP_003402923.1.34841 WP_003402923.1.34908 WP_003402923.1.34919 WP_003402923.1.3492 WP_003402923.1.34933 WP_003402923.1.34945 WP_003402923.1.34946 WP_003402923.1.34954 WP_003402923.1.34960 WP_003402923.1.34961 WP_003402923.1.34963 WP_003402923.1.34965 WP_003402923.1.34968 WP_003402923.1.35023 WP_003402923.1.35069 WP_003402923.1.35072 WP_003402923.1.35078 WP_003402923.1.35100 WP_003402923.1.35146 WP_003402923.1.35156 WP_003402923.1.35160 WP_003402923.1.35162 WP_003402923.1.35173 WP_003402923.1.35176 WP_003402923.1.3520 WP_003402923.1.35213 WP_003402923.1.35221 WP_003402923.1.35246 WP_003402923.1.35278 WP_003402923.1.35301 WP_003402923.1.35311 WP_003402923.1.35312 WP_003402923.1.35317 WP_003402923.1.35319 WP_003402923.1.35347 WP_003402923.1.35363 WP_003402923.1.35382 WP_003402923.1.35385 WP_003402923.1.35396 WP_003402923.1.35397 WP_003402923.1.35426 WP_003402923.1.35439 WP_003402923.1.35455 WP_003402923.1.3548 WP_003402923.1.35484 WP_003402923.1.35492 WP_003402923.1.3553 WP_003402923.1.35553 WP_003402923.1.35555 WP_003402923.1.35561 WP_003402923.1.35602 WP_003402923.1.35610 WP_003402923.1.35635 WP_003402923.1.35657 WP_003402923.1.35687 WP_003402923.1.35689 WP_003402923.1.35707 WP_003402923.1.35732 WP_003402923.1.35754 WP_003402923.1.35767 WP_003402923.1.35770 WP_003402923.1.35771 WP_003402923.1.35780 WP_003402923.1.35805 WP_003402923.1.35811 WP_003402923.1.35821 WP_003402923.1.3584 WP_003402923.1.35848 WP_003402923.1.35864 WP_003402923.1.35874 WP_003402923.1.35876 WP_003402923.1.35897 WP_003402923.1.35899 WP_003402923.1.35923 WP_003402923.1.3593 WP_003402923.1.35954 WP_003402923.1.36005 WP_003402923.1.36014 WP_003402923.1.36023 WP_003402923.1.36051 WP_003402923.1.36053 WP_003402923.1.36075 WP_003402923.1.36089 WP_003402923.1.36097 WP_003402923.1.36098 WP_003402923.1.36116 WP_003402923.1.36145 WP_003402923.1.36156 WP_003402923.1.36205 WP_003402923.1.36228 WP_003402923.1.36246 WP_003402923.1.36252 WP_003402923.1.36260 WP_003402923.1.36270 WP_003402923.1.36271 WP_003402923.1.36303 WP_003402923.1.36309 WP_003402923.1.36315 WP_003402923.1.36319 WP_003402923.1.36321 WP_003402923.1.36326 WP_003402923.1.3634 WP_003402923.1.36356 WP_003402923.1.36357 WP_003402923.1.3636 WP_003402923.1.36385 WP_003402923.1.36399 WP_003402923.1.36436 WP_003402923.1.36465 WP_003402923.1.36469 WP_003402923.1.36473 WP_003402923.1.36485 WP_003402923.1.36508 WP_003402923.1.36540 WP_003402923.1.36561 WP_003402923.1.36571 WP_003402923.1.36573 WP_003402923.1.36578 WP_003402923.1.36585 WP_003402923.1.36597 WP_003402923.1.36614 WP_003402923.1.36657 WP_003402923.1.36674 WP_003402923.1.36720 WP_003402923.1.36727 WP_003402923.1.36733 WP_003402923.1.36810 WP_003402923.1.36844 WP_003402923.1.36851 WP_003402923.1.36862 WP_003402923.1.36893 WP_003402923.1.36901 WP_003402923.1.36935 WP_003402923.1.36941 WP_003402923.1.3695 WP_003402923.1.36951 WP_003402923.1.36968 WP_003402923.1.3700 WP_003402923.1.37004 WP_003402923.1.37012 WP_003402923.1.37071 WP_003402923.1.37088 WP_003402923.1.37157 WP_003402923.1.37175 WP_003402923.1.37188 WP_003402923.1.37213 WP_003402923.1.37229 WP_003402923.1.3724 WP_003402923.1.37277 WP_003402923.1.37305 WP_003402923.1.37330 WP_003402923.1.37389 WP_003402923.1.37400 WP_003402923.1.37440 WP_003402923.1.37459 WP_003402923.1.37468 WP_003402923.1.37475 WP_003402923.1.37484 WP_003402923.1.37601 WP_003402923.1.37612 WP_003402923.1.37632 WP_003402923.1.37643 WP_003402923.1.37655 WP_003402923.1.37660 WP_003402923.1.37674 WP_003402923.1.37700 WP_003402923.1.37701 WP_003402923.1.37709 WP_003402923.1.37711 WP_003402923.1.37721 WP_003402923.1.37722 WP_003402923.1.37747 WP_003402923.1.37765 WP_003402923.1.37772 WP_003402923.1.37804 WP_003402923.1.37809 WP_003402923.1.37859 WP_003402923.1.37877 WP_003402923.1.37912 WP_003402923.1.37913 WP_003402923.1.37943 WP_003402923.1.37950 WP_003402923.1.37973 WP_003402923.1.37975 WP_003402923.1.37983 WP_003402923.1.38 WP_003402923.1.38002 WP_003402923.1.3802 WP_003402923.1.38039 WP_003402923.1.38040 WP_003402923.1.38067 WP_003402923.1.38068 WP_003402923.1.38135 WP_003402923.1.38138 WP_003402923.1.38144 WP_003402923.1.38158 WP_003402923.1.38159 WP_003402923.1.38210 WP_003402923.1.38233 WP_003402923.1.38240 WP_003402923.1.38299 WP_003402923.1.38332 WP_003402923.1.38347 WP_003402923.1.38354 WP_003402923.1.38380 WP_003402923.1.38384 WP_003402923.1.38389 WP_003402923.1.38398 WP_003402923.1.38402 WP_003402923.1.38418 WP_003402923.1.38421 WP_003402923.1.38466 WP_003402923.1.38483 WP_003402923.1.3849 WP_003402923.1.385 WP_003402923.1.38530 WP_003402923.1.38535 WP_003402923.1.38539 WP_003402923.1.38594 WP_003402923.1.38601 WP_003402923.1.38611 WP_003402923.1.38638 WP_003402923.1.38639 WP_003402923.1.38646 WP_003402923.1.38648 WP_003402923.1.38654 WP_003402923.1.38659 WP_003402923.1.38660 WP_003402923.1.38666 WP_003402923.1.38671 WP_003402923.1.38672 WP_003402923.1.38677 WP_003402923.1.38750 WP_003402923.1.38772 WP_003402923.1.38812 WP_003402923.1.38821 WP_003402923.1.38844 WP_003402923.1.38863 WP_003402923.1.38865 WP_003402923.1.38873 WP_003402923.1.3889 WP_003402923.1.38894 WP_003402923.1.38909 WP_003402923.1.38939 WP_003402923.1.38974 WP_003402923.1.38975 WP_003402923.1.38991 WP_003402923.1.39025 WP_003402923.1.39070 WP_003402923.1.39072 WP_003402923.1.39095 WP_003402923.1.39106 WP_003402923.1.39165 WP_003402923.1.39174 WP_003402923.1.39176 WP_003402923.1.39178 WP_003402923.1.39190 WP_003402923.1.39201 WP_003402923.1.39207 WP_003402923.1.39211 WP_003402923.1.39236 WP_003402923.1.39239 WP_003402923.1.39252 WP_003402923.1.39288 WP_003402923.1.39295 WP_003402923.1.39306 WP_003402923.1.39359 WP_003402923.1.39364 WP_003402923.1.39400 WP_003402923.1.39447 WP_003402923.1.3945 WP_003402923.1.39450 WP_003402923.1.39455 WP_003402923.1.3949 WP_003402923.1.39521 WP_003402923.1.39560 WP_003402923.1.39592 WP_003402923.1.39593 WP_003402923.1.396 WP_003402923.1.3960 WP_003402923.1.39616 WP_003402923.1.39654 WP_003402923.1.39657 WP_003402923.1.39661 WP_003402923.1.39674 WP_003402923.1.39678 WP_003402923.1.3968 WP_003402923.1.39694 WP_003402923.1.3971 WP_003402923.1.39718 WP_003402923.1.39728 WP_003402923.1.39739 WP_003402923.1.39748 WP_003402923.1.39751 WP_003402923.1.39759 WP_003402923.1.39801 WP_003402923.1.39804 WP_003402923.1.39848 WP_003402923.1.39877 WP_003402923.1.39925 WP_003402923.1.3994 WP_003402923.1.39959 WP_003402923.1.3996 WP_003402923.1.39960 WP_003402923.1.3997 WP_003402923.1.39980 WP_003402923.1.40000 WP_003402923.1.40028 WP_003402923.1.4003 WP_003402923.1.40094 WP_003402923.1.40096 WP_003402923.1.40150 WP_003402923.1.40156 WP_003402923.1.40174 WP_003402923.1.40186 WP_003402923.1.40276 WP_003402923.1.40277 WP_003402923.1.40323 WP_003402923.1.40336 WP_003402923.1.40353 WP_003402923.1.4036 WP_003402923.1.40372 WP_003402923.1.40402 WP_003402923.1.40413 WP_003402923.1.40440 WP_003402923.1.40446 WP_003402923.1.40451 WP_003402923.1.40455 WP_003402923.1.40523 WP_003402923.1.40543 WP_003402923.1.40641 WP_003402923.1.40646 WP_003402923.1.40651 WP_003402923.1.40653 WP_003402923.1.4067 WP_003402923.1.40705 WP_003402923.1.40723 WP_003402923.1.40731 WP_003402923.1.40735 WP_003402923.1.40795 WP_003402923.1.40799 WP_003402923.1.40852 WP_003402923.1.40876 WP_003402923.1.40881 WP_003402923.1.40922 WP_003402923.1.40948 WP_003402923.1.4095 WP_003402923.1.40956 WP_003402923.1.40957 WP_003402923.1.40964 WP_003402923.1.4097 WP_003402923.1.410 WP_003402923.1.41000 WP_003402923.1.41055 WP_003402923.1.41108 WP_003402923.1.41123 WP_003402923.1.41177 WP_003402923.1.41202 WP_003402923.1.41219 WP_003402923.1.41231 WP_003402923.1.41249 WP_003402923.1.4127 WP_003402923.1.41296 WP_003402923.1.41355 WP_003402923.1.41376 WP_003402923.1.41430 WP_003402923.1.41447 WP_003402923.1.41469 WP_003402923.1.41504 WP_003402923.1.41553 WP_003402923.1.41564 WP_003402923.1.41583 WP_003402923.1.41616 WP_003402923.1.41632 WP_003402923.1.41635 WP_003402923.1.41636 WP_003402923.1.41648 WP_003402923.1.41660 WP_003402923.1.41685 WP_003402923.1.41695 WP_003402923.1.41704 WP_003402923.1.4171 WP_003402923.1.41719 WP_003402923.1.41733 WP_003402923.1.41744 WP_003402923.1.41774 WP_003402923.1.41791 WP_003402923.1.41803 WP_003402923.1.41820 WP_003402923.1.41828 WP_003402923.1.41829 WP_003402923.1.41860 WP_003402923.1.41912 WP_003402923.1.41921 WP_003402923.1.41933 WP_003402923.1.41944 WP_003402923.1.42043 WP_003402923.1.42075 WP_003402923.1.42078 WP_003402923.1.42094 WP_003402923.1.4212 WP_003402923.1.42122 WP_003402923.1.42134 WP_003402923.1.42183 WP_003402923.1.42188 WP_003402923.1.42201 WP_003402923.1.42202 WP_003402923.1.42208 WP_003402923.1.42247 WP_003402923.1.42255 WP_003402923.1.42273 WP_003402923.1.42278 WP_003402923.1.42304 WP_003402923.1.42309 WP_003402923.1.42370 WP_003402923.1.42385 WP_003402923.1.42400 WP_003402923.1.42414 WP_003402923.1.42417 WP_003402923.1.42430 WP_003402923.1.42461 WP_003402923.1.42465 WP_003402923.1.42467 WP_003402923.1.42473 WP_003402923.1.42474 WP_003402923.1.4248 WP_003402923.1.42494 WP_003402923.1.42519 WP_003402923.1.42524 WP_003402923.1.42534 WP_003402923.1.4255 WP_003402923.1.42562 WP_003402923.1.42568 WP_003402923.1.42570 WP_003402923.1.42618 WP_003402923.1.42660 WP_003402923.1.42695 WP_003402923.1.42704 WP_003402923.1.42705 WP_003402923.1.42722 WP_003402923.1.42777 WP_003402923.1.42782 WP_003402923.1.42835 WP_003402923.1.42839 WP_003402923.1.42842 WP_003402923.1.42905 WP_003402923.1.42916 WP_003402923.1.42930 WP_003402923.1.42971 WP_003402923.1.43005 WP_003402923.1.43009 WP_003402923.1.43053 WP_003402923.1.43082 WP_003402923.1.43087 WP_003402923.1.43098 WP_003402923.1.43208 WP_003402923.1.43236 WP_003402923.1.43246 WP_003402923.1.43255 WP_003402923.1.43266 WP_003402923.1.43269 WP_003402923.1.43273 WP_003402923.1.43296 WP_003402923.1.43306 WP_003402923.1.4335 WP_003402923.1.43368 WP_003402923.1.43395 WP_003402923.1.43457 WP_003402923.1.43462 WP_003402923.1.43475 WP_003402923.1.43478 WP_003402923.1.43484 WP_003402923.1.43557 WP_003402923.1.43578 WP_003402923.1.43588 WP_003402923.1.43643 WP_003402923.1.43664 WP_003402923.1.43684 WP_003402923.1.43686 WP_003402923.1.43706 WP_003402923.1.43716 WP_003402923.1.4377 WP_003402923.1.43781 WP_003402923.1.43794 WP_003402923.1.43815 WP_003402923.1.43846 WP_003402923.1.43861 WP_003402923.1.43863 WP_003402923.1.43866 WP_003402923.1.43872 WP_003402923.1.43885 WP_003402923.1.43897 WP_003402923.1.4390 WP_003402923.1.43902 WP_003402923.1.43921 WP_003402923.1.43936 WP_003402923.1.43937 WP_003402923.1.43960 WP_003402923.1.43965 WP_003402923.1.4399 WP_003402923.1.43993 WP_003402923.1.43996 WP_003402923.1.44 WP_003402923.1.44001 WP_003402923.1.44008 WP_003402923.1.44016 WP_003402923.1.44033 WP_003402923.1.44037 WP_003402923.1.44041 WP_003402923.1.44070 WP_003402923.1.44071 WP_003402923.1.44076 WP_003402923.1.44104 WP_003402923.1.44111 WP_003402923.1.44124 WP_003402923.1.44169 WP_003402923.1.44219 WP_003402923.1.44237 WP_003402923.1.44277 WP_003402923.1.44279 WP_003402923.1.44336 WP_003402923.1.44355 WP_003402923.1.44358 WP_003402923.1.4438 WP_003402923.1.44392 WP_003402923.1.4441 WP_003402923.1.44415 WP_003402923.1.44464 WP_003402923.1.44466 WP_003402923.1.44489 WP_003402923.1.44492 WP_003402923.1.44494 WP_003402923.1.44500 WP_003402923.1.44519 WP_003402923.1.44526 WP_003402923.1.44532 WP_003402923.1.44534 WP_003402923.1.44562 WP_003402923.1.44589 WP_003402923.1.44597 WP_003402923.1.44600 WP_003402923.1.44602 WP_003402923.1.44615 WP_003402923.1.4464 WP_003402923.1.44651 WP_003402923.1.44659 WP_003402923.1.44665 WP_003402923.1.44694 WP_003402923.1.44700 WP_003402923.1.44713 WP_003402923.1.44735 WP_003402923.1.44740 WP_003402923.1.44757 WP_003402923.1.4476 WP_003402923.1.44761 WP_003402923.1.44767 WP_003402923.1.44776 WP_003402923.1.44779 WP_003402923.1.44786 WP_003402923.1.44808 WP_003402923.1.44864 WP_003402923.1.44901 WP_003402923.1.44908 WP_003402923.1.44913 WP_003402923.1.4492 WP_003402923.1.44939 WP_003402923.1.44979 WP_003402923.1.44981 WP_003402923.1.45002 WP_003402923.1.45011 WP_003402923.1.4504 WP_003402923.1.45066 WP_003402923.1.45081 WP_003402923.1.45113 WP_003402923.1.45129 WP_003402923.1.45135 WP_003402923.1.45147 WP_003402923.1.45168 WP_003402923.1.4517 WP_003402923.1.45181 WP_003402923.1.45185 WP_003402923.1.45192 WP_003402923.1.45200 WP_003402923.1.45205 WP_003402923.1.45211 WP_003402923.1.45249 WP_003402923.1.4526 WP_003402923.1.45286 WP_003402923.1.45326 WP_003402923.1.45347 WP_003402923.1.45374 WP_003402923.1.45390 WP_003402923.1.454 WP_003402923.1.45407 WP_003402923.1.45451 WP_003402923.1.45453 WP_003402923.1.45460 WP_003402923.1.45463 WP_003402923.1.45470 WP_003402923.1.45474 WP_003402923.1.45491 WP_003402923.1.45510 WP_003402923.1.45563 WP_003402923.1.45584 WP_003402923.1.45590 WP_003402923.1.45619 WP_003402923.1.45626 WP_003402923.1.45631 WP_003402923.1.45666 WP_003402923.1.45697 WP_003402923.1.4571 WP_003402923.1.45731 WP_003402923.1.45743 WP_003402923.1.45765 WP_003402923.1.45776 WP_003402923.1.45783 WP_003402923.1.45805 WP_003402923.1.45815 WP_003402923.1.45849 WP_003402923.1.45867 WP_003402923.1.45884 WP_003402923.1.4590 WP_003402923.1.45923 WP_003402923.1.45926 WP_003402923.1.45963 WP_003402923.1.45989 WP_003402923.1.45992 WP_003402923.1.46025 WP_003402923.1.46083 WP_003402923.1.46090 WP_003402923.1.46092 WP_003402923.1.46100 WP_003402923.1.46101 WP_003402923.1.46103 WP_003402923.1.46107 WP_003402923.1.46127 WP_003402923.1.46128 WP_003402923.1.46129 WP_003402923.1.46141 WP_003402923.1.46150 WP_003402923.1.46201 WP_003402923.1.46226 WP_003402923.1.4624 WP_003402923.1.46253 WP_003402923.1.46268 WP_003402923.1.46285 WP_003402923.1.46300 WP_003402923.1.46313 WP_003402923.1.46336 WP_003402923.1.46365 WP_003402923.1.46370 WP_003402923.1.46381 WP_003402923.1.46402 WP_003402923.1.46411 WP_003402923.1.4644 WP_003402923.1.46442 WP_003402923.1.46453 WP_003402923.1.46463 WP_003402923.1.46478 WP_003402923.1.46492 WP_003402923.1.46521 WP_003402923.1.4653 WP_003402923.1.46532 WP_003402923.1.46539 WP_003402923.1.46568 WP_003402923.1.46585 WP_003402923.1.46609 WP_003402923.1.46613 WP_003402923.1.46625 WP_003402923.1.46642 WP_003402923.1.46647 WP_003402923.1.46674 WP_003402923.1.46724 WP_003402923.1.46758 WP_003402923.1.46773 WP_003402923.1.46777 WP_003402923.1.46786 WP_003402923.1.46792 WP_003402923.1.46847 WP_003402923.1.46851 WP_003402923.1.4687 WP_003402923.1.46897 WP_003402923.1.46936 WP_003402923.1.46980 WP_003402923.1.47011 WP_003402923.1.47012 WP_003402923.1.47066 WP_003402923.1.47077 WP_003402923.1.47083 WP_003402923.1.47106 WP_003402923.1.47142 WP_003402923.1.47147 WP_003402923.1.47166 WP_003402923.1.47178 WP_003402923.1.47179 WP_003402923.1.47194 WP_003402923.1.47207 WP_003402923.1.47210 WP_003402923.1.47261 WP_003402923.1.47262 WP_003402923.1.47402 WP_003402923.1.47423 WP_003402923.1.47467 WP_003402923.1.47502 WP_003402923.1.4751 WP_003402923.1.47511 WP_003402923.1.47537 WP_003402923.1.47540 WP_003402923.1.47568 WP_003402923.1.47572 WP_003402923.1.47588 WP_003402923.1.47636 WP_003402923.1.4764 WP_003402923.1.47679 WP_003402923.1.47681 WP_003402923.1.47690 WP_003402923.1.4771 WP_003402923.1.47717 WP_003402923.1.47743 WP_003402923.1.47754 WP_003402923.1.47773 WP_003402923.1.47776 WP_003402923.1.47780 WP_003402923.1.47805 WP_003402923.1.47832 WP_003402923.1.47847 WP_003402923.1.47858 WP_003402923.1.47861 WP_003402923.1.47893 WP_003402923.1.47899 WP_003402923.1.479 WP_003402923.1.47912 WP_003402923.1.47913 WP_003402923.1.47926 WP_003402923.1.4794 WP_003402923.1.47943 WP_003402923.1.47944 WP_003402923.1.47959 WP_003402923.1.47974 WP_003402923.1.47993 WP_003402923.1.48004 WP_003402923.1.48039 WP_003402923.1.48050 WP_003402923.1.48084 WP_003402923.1.48097 WP_003402923.1.48101 WP_003402923.1.48109 WP_003402923.1.4813 WP_003402923.1.48130 WP_003402923.1.48135 WP_003402923.1.48143 WP_003402923.1.48152 WP_003402923.1.48155 WP_003402923.1.48170 WP_003402923.1.48173 WP_003402923.1.48177 WP_003402923.1.48185 WP_003402923.1.48204 WP_003402923.1.48219 WP_003402923.1.4823 WP_003402923.1.48256 WP_003402923.1.48264 WP_003402923.1.48287 WP_003402923.1.48330 WP_003402923.1.48333 WP_003402923.1.48348 WP_003402923.1.48354 WP_003402923.1.48372 WP_003402923.1.48383 WP_003402923.1.48388 WP_003402923.1.48419 WP_003402923.1.48443 WP_003402923.1.48450 WP_003402923.1.48462 WP_003402923.1.48543 WP_003402923.1.48550 WP_003402923.1.48605 WP_003402923.1.48618 WP_003402923.1.4863 WP_003402923.1.48648 WP_003402923.1.48658 WP_003402923.1.48666 WP_003402923.1.48687 WP_003402923.1.48779 WP_003402923.1.4878 WP_003402923.1.48798 WP_003402923.1.48802 WP_003402923.1.48826 WP_003402923.1.48831 WP_003402923.1.48843 WP_003402923.1.48857 WP_003402923.1.4890 WP_003402923.1.48946 WP_003402923.1.48979 WP_003402923.1.49017 WP_003402923.1.49048 WP_003402923.1.49059 WP_003402923.1.4906 WP_003402923.1.4907 WP_003402923.1.49103 WP_003402923.1.49110 WP_003402923.1.49111 WP_003402923.1.49112 WP_003402923.1.4919 WP_003402923.1.49251 WP_003402923.1.49254 WP_003402923.1.49263 WP_003402923.1.49291 WP_003402923.1.49296 WP_003402923.1.49335 WP_003402923.1.49337 WP_003402923.1.49419 WP_003402923.1.49426 WP_003402923.1.49437 WP_003402923.1.49439 WP_003402923.1.49474 WP_003402923.1.49506 WP_003402923.1.49516 WP_003402923.1.49523 WP_003402923.1.49526 WP_003402923.1.49532 WP_003402923.1.49588 WP_003402923.1.4959 WP_003402923.1.49678 WP_003402923.1.49687 WP_003402923.1.49699 WP_003402923.1.49709 WP_003402923.1.4971 WP_003402923.1.4972 WP_003402923.1.49736 WP_003402923.1.49746 WP_003402923.1.49764 WP_003402923.1.49773 WP_003402923.1.49796 WP_003402923.1.49814 WP_003402923.1.49815 WP_003402923.1.49816 WP_003402923.1.49839 WP_003402923.1.49857 WP_003402923.1.49878 WP_003402923.1.49880 WP_003402923.1.49944 WP_003402923.1.4999 WP_003402923.1.49990 WP_003402923.1.50068 WP_003402923.1.50077 WP_003402923.1.5008 WP_003402923.1.50081 WP_003402923.1.50122 WP_003402923.1.50126 WP_003402923.1.50149 WP_003402923.1.50162 WP_003402923.1.5018 WP_003402923.1.50194 WP_003402923.1.50218 WP_003402923.1.50235 WP_003402923.1.50249 WP_003402923.1.50265 WP_003402923.1.50271 WP_003402923.1.50324 WP_003402923.1.50347 WP_003402923.1.50372 WP_003402923.1.50398 WP_003402923.1.50444 WP_003402923.1.50466 WP_003402923.1.50472 WP_003402923.1.5048 WP_003402923.1.50498 WP_003402923.1.5050 WP_003402923.1.50540 WP_003402923.1.50554 WP_003402923.1.50557 WP_003402923.1.50601 WP_003402923.1.50610 WP_003402923.1.50632 WP_003402923.1.50633 WP_003402923.1.50642 WP_003402923.1.50655 WP_003402923.1.50659 WP_003402923.1.50683 WP_003402923.1.50689 WP_003402923.1.50692 WP_003402923.1.50714 WP_003402923.1.50729 WP_003402923.1.50756 WP_003402923.1.50784 WP_003402923.1.50794 WP_003402923.1.50841 WP_003402923.1.50860 WP_003402923.1.50868 WP_003402923.1.50877 WP_003402923.1.5096 WP_003402923.1.50981 WP_003402923.1.50987 WP_003402923.1.51003 WP_003402923.1.51009 WP_003402923.1.51037 WP_003402923.1.51074 WP_003402923.1.51082 WP_003402923.1.51101 WP_003402923.1.51116 WP_003402923.1.51149 WP_003402923.1.51157 WP_003402923.1.51213 WP_003402923.1.51232 WP_003402923.1.51239 WP_003402923.1.51247 WP_003402923.1.51279 WP_003402923.1.51291 WP_003402923.1.51294 WP_003402923.1.51301 WP_003402923.1.51329 WP_003402923.1.51391 WP_003402923.1.51422 WP_003402923.1.51445 WP_003402923.1.51455 WP_003402923.1.51466 WP_003402923.1.51468 WP_003402923.1.51478 WP_003402923.1.51497 WP_003402923.1.51520 WP_003402923.1.51593 WP_003402923.1.51628 WP_003402923.1.5164 WP_003402923.1.51647 WP_003402923.1.51660 WP_003402923.1.51696 WP_003402923.1.51721 WP_003402923.1.51788 WP_003402923.1.51795 WP_003402923.1.51801 WP_003402923.1.51817 WP_003402923.1.51819 WP_003402923.1.51854 WP_003402923.1.51923 WP_003402923.1.51942 WP_003402923.1.51948 WP_003402923.1.51963 WP_003402923.1.51969 WP_003402923.1.52000 WP_003402923.1.52001 WP_003402923.1.52003 WP_003402923.1.52006 WP_003402923.1.52036 WP_003402923.1.52038 WP_003402923.1.52046 WP_003402923.1.52059 WP_003402923.1.52069 WP_003402923.1.52082 WP_003402923.1.52102 WP_003402923.1.52166 WP_003402923.1.52168 WP_003402923.1.52173 WP_003402923.1.52178 WP_003402923.1.52206 WP_003402923.1.52216 WP_003402923.1.52238 WP_003402923.1.52241 WP_003402923.1.52280 WP_003402923.1.52314 WP_003402923.1.52385 WP_003402923.1.52390 WP_003402923.1.524 WP_003402923.1.52460 WP_003402923.1.52485 WP_003402923.1.52486 WP_003402923.1.52495 WP_003402923.1.52504 WP_003402923.1.52522 WP_003402923.1.52531 WP_003402923.1.52533 WP_003402923.1.52545 WP_003402923.1.52553 WP_003402923.1.52563 WP_003402923.1.52564 WP_003402923.1.52574 WP_003402923.1.52641 WP_003402923.1.52673 WP_003402923.1.52674 WP_003402923.1.52708 WP_003402923.1.52713 WP_003402923.1.52761 WP_003402923.1.52778 WP_003402923.1.52791 WP_003402923.1.52797 WP_003402923.1.52818 WP_003402923.1.52872 WP_003402923.1.52873 WP_003402923.1.52891 WP_003402923.1.52892 WP_003402923.1.52909 WP_003402923.1.52970 WP_003402923.1.52998 WP_003402923.1.53053 WP_003402923.1.53056 WP_003402923.1.5306 WP_003402923.1.53088 WP_003402923.1.5309 WP_003402923.1.531 WP_003402923.1.53117 WP_003402923.1.53118 WP_003402923.1.53142 WP_003402923.1.53143 WP_003402923.1.53157 WP_003402923.1.53167 WP_003402923.1.53200 WP_003402923.1.53204 WP_003402923.1.53213 WP_003402923.1.53217 WP_003402923.1.53226 WP_003402923.1.53229 WP_003402923.1.53230 WP_003402923.1.53237 WP_003402923.1.53254 WP_003402923.1.53257 WP_003402923.1.5327 WP_003402923.1.53276 WP_003402923.1.53278 WP_003402923.1.533 WP_003402923.1.53302 WP_003402923.1.53306 WP_003402923.1.5334 WP_003402923.1.5335 WP_003402923.1.53353 WP_003402923.1.53381 WP_003402923.1.53413 WP_003402923.1.53458 WP_003402923.1.53460 WP_003402923.1.53480 WP_003402923.1.53517 WP_003402923.1.53522 WP_003402923.1.53525 WP_003402923.1.53526 WP_003402923.1.53553 WP_003402923.1.53606 WP_003402923.1.53609 WP_003402923.1.53628 WP_003402923.1.53643 WP_003402923.1.53667 WP_003402923.1.53679 WP_003402923.1.53715 WP_003402923.1.53730 WP_003402923.1.53742 WP_003402923.1.53743 WP_003402923.1.53754 WP_003402923.1.53775 WP_003402923.1.53787 WP_003402923.1.53803 WP_003402923.1.53818 WP_003402923.1.53822 WP_003402923.1.53853 WP_003402923.1.53865 WP_003402923.1.53888 WP_003402923.1.53900 WP_003402923.1.53912 WP_003402923.1.53914 WP_003402923.1.53952 WP_003402923.1.5398 WP_003402923.1.5408 WP_003402923.1.54089 WP_003402923.1.54093 WP_003402923.1.54099 WP_003402923.1.54112 WP_003402923.1.54125 WP_003402923.1.54141 WP_003402923.1.54162 WP_003402923.1.54179 WP_003402923.1.54218 WP_003402923.1.54225 WP_003402923.1.54227 WP_003402923.1.54232 WP_003402923.1.54241 WP_003402923.1.54245 WP_003402923.1.54247 WP_003402923.1.54260 WP_003402923.1.54280 WP_003402923.1.5429 WP_003402923.1.54294 WP_003402923.1.54314 WP_003402923.1.54347 WP_003402923.1.54370 WP_003402923.1.54428 WP_003402923.1.54449 WP_003402923.1.54494 WP_003402923.1.54502 WP_003402923.1.54514 WP_003402923.1.54519 WP_003402923.1.5452 WP_003402923.1.54531 WP_003402923.1.54537 WP_003402923.1.54553 WP_003402923.1.54555 WP_003402923.1.54575 WP_003402923.1.54633 WP_003402923.1.54687 WP_003402923.1.54705 WP_003402923.1.54730 WP_003402923.1.54732 WP_003402923.1.5475 WP_003402923.1.54797 WP_003402923.1.54807 WP_003402923.1.54836 WP_003402923.1.54838 WP_003402923.1.54860 WP_003402923.1.54888 WP_003402923.1.54897 WP_003402923.1.54905 WP_003402923.1.54909 WP_003402923.1.54937 WP_003402923.1.54939 WP_003402923.1.54944 WP_003402923.1.54945 WP_003402923.1.54953 WP_003402923.1.54964 WP_003402923.1.55015 WP_003402923.1.55022 WP_003402923.1.55023 WP_003402923.1.55051 WP_003402923.1.55072 WP_003402923.1.55088 WP_003402923.1.55106 WP_003402923.1.55126 WP_003402923.1.55128 WP_003402923.1.55140 WP_003402923.1.55150 WP_003402923.1.55210 WP_003402923.1.55227 WP_003402923.1.55248 WP_003402923.1.55257 WP_003402923.1.55258 WP_003402923.1.55267 WP_003402923.1.55279 WP_003402923.1.55307 WP_003402923.1.55326 WP_003402923.1.55328 WP_003402923.1.5533 WP_003402923.1.55345 WP_003402923.1.55396 WP_003402923.1.55398 WP_003402923.1.55441 WP_003402923.1.55459 WP_003402923.1.55504 WP_003402923.1.55578 WP_003402923.1.55626 WP_003402923.1.55641 WP_003402923.1.5569 WP_003402923.1.55723 WP_003402923.1.55735 WP_003402923.1.5574 WP_003402923.1.55772 WP_003402923.1.55802 WP_003402923.1.55807 WP_003402923.1.55819 WP_003402923.1.55821 WP_003402923.1.5583 WP_003402923.1.55849 WP_003402923.1.55856 WP_003402923.1.55860 WP_003402923.1.55882 WP_003402923.1.55883 WP_003402923.1.55894 WP_003402923.1.55902 WP_003402923.1.55908 WP_003402923.1.55909 WP_003402923.1.5591 WP_003402923.1.55961 WP_003402923.1.55977 WP_003402923.1.56028 WP_003402923.1.56057 WP_003402923.1.56060 WP_003402923.1.56107 WP_003402923.1.56132 WP_003402923.1.56163 WP_003402923.1.56167 WP_003402923.1.56178 WP_003402923.1.56287 WP_003402923.1.56292 WP_003402923.1.56327 WP_003402923.1.56341 WP_003402923.1.56359 WP_003402923.1.56365 WP_003402923.1.56394 WP_003402923.1.56443 WP_003402923.1.56478 WP_003402923.1.56500 WP_003402923.1.56517 WP_003402923.1.56534 WP_003402923.1.5656 WP_003402923.1.56577 WP_003402923.1.56593 WP_003402923.1.56625 WP_003402923.1.56637 WP_003402923.1.56670 WP_003402923.1.56697 WP_003402923.1.567 WP_003402923.1.56701 WP_003402923.1.56709 WP_003402923.1.56729 WP_003402923.1.56743 WP_003402923.1.56755 WP_003402923.1.56764 WP_003402923.1.56769 WP_003402923.1.56770 WP_003402923.1.56795 WP_003402923.1.5681 WP_003402923.1.56827 WP_003402923.1.56839 WP_003402923.1.56863 WP_003402923.1.56868 WP_003402923.1.56869 WP_003402923.1.56915 WP_003402923.1.56926 WP_003402923.1.56961 WP_003402923.1.56971 WP_003402923.1.56972 WP_003402923.1.57023 WP_003402923.1.57035 WP_003402923.1.57077 WP_003402923.1.57087 WP_003402923.1.57094 WP_003402923.1.57134 WP_003402923.1.57151 WP_003402923.1.57169 WP_003402923.1.57208 WP_003402923.1.57212 WP_003402923.1.57230 WP_003402923.1.5724 WP_003402923.1.5725 WP_003402923.1.5727 WP_003402923.1.57273 WP_003402923.1.573 WP_003402923.1.57314 WP_003402923.1.57326 WP_003402923.1.57328 WP_003402923.1.57331 WP_003402923.1.57340 WP_003402923.1.57351 WP_003402923.1.57352 WP_003402923.1.57380 WP_003402923.1.57430 WP_003402923.1.5744 WP_003402923.1.57440 WP_003402923.1.5745 WP_003402923.1.57461 WP_003402923.1.57469 WP_003402923.1.575 WP_003402923.1.57509 WP_003402923.1.57519 WP_003402923.1.57525 WP_003402923.1.57551 WP_003402923.1.5758 WP_003402923.1.57596 WP_003402923.1.57604 WP_003402923.1.57616 WP_003402923.1.57617 WP_003402923.1.57619 WP_003402923.1.57627 WP_003402923.1.57642 WP_003402923.1.57658 WP_003402923.1.57667 WP_003402923.1.57675 WP_003402923.1.57708 WP_003402923.1.57794 WP_003402923.1.57821 WP_003402923.1.57825 WP_003402923.1.57843 WP_003402923.1.57906 WP_003402923.1.57924 WP_003402923.1.57926 WP_003402923.1.57930 WP_003402923.1.57957 WP_003402923.1.57960 WP_003402923.1.57964 WP_003402923.1.57991 WP_003402923.1.58000 WP_003402923.1.58086 WP_003402923.1.58101 WP_003402923.1.58103 WP_003402923.1.58108 WP_003402923.1.5811 WP_003402923.1.58121 WP_003402923.1.58145 WP_003402923.1.58164 WP_003402923.1.58174 WP_003402923.1.582 WP_003402923.1.58202 WP_003402923.1.58209 WP_003402923.1.58215 WP_003402923.1.5824 WP_003402923.1.58250 WP_003402923.1.58259 WP_003402923.1.58283 WP_003402923.1.58288 WP_003402923.1.5830 WP_003402923.1.58303 WP_003402923.1.58311 WP_003402923.1.58330 WP_003402923.1.58359 WP_003402923.1.58386 WP_003402923.1.58393 WP_003402923.1.58431 WP_003402923.1.5844 WP_003402923.1.58488 WP_003402923.1.58518 WP_003402923.1.58534 WP_003402923.1.58559 WP_003402923.1.58567 WP_003402923.1.58573 WP_003402923.1.58602 WP_003402923.1.58612 WP_003402923.1.58619 WP_003402923.1.58630 WP_003402923.1.5865 WP_003402923.1.58671 WP_003402923.1.58690 WP_003402923.1.58702 WP_003402923.1.58743 WP_003402923.1.58754 WP_003402923.1.5879 WP_003402923.1.5881 WP_003402923.1.58824 WP_003402923.1.58848 WP_003402923.1.58857 WP_003402923.1.58891 WP_003402923.1.58892 WP_003402923.1.5890 WP_003402923.1.58904 WP_003402923.1.58921 WP_003402923.1.58930 WP_003402923.1.58939 WP_003402923.1.58941 WP_003402923.1.58953 WP_003402923.1.58961 WP_003402923.1.5898 WP_003402923.1.59025 WP_003402923.1.59029 WP_003402923.1.59037 WP_003402923.1.59044 WP_003402923.1.59085 WP_003402923.1.59088 WP_003402923.1.59112 WP_003402923.1.59130 WP_003402923.1.5914 WP_003402923.1.59147 WP_003402923.1.59166 WP_003402923.1.59205 WP_003402923.1.59209 WP_003402923.1.59237 WP_003402923.1.59240 WP_003402923.1.59253 WP_003402923.1.59254 WP_003402923.1.59262 WP_003402923.1.59270 WP_003402923.1.5928 WP_003402923.1.59304 WP_003402923.1.59305 WP_003402923.1.59309 WP_003402923.1.59316 WP_003402923.1.59326 WP_003402923.1.59328 WP_003402923.1.59333 WP_003402923.1.59338 WP_003402923.1.59388 WP_003402923.1.59487 WP_003402923.1.59537 WP_003402923.1.59561 WP_003402923.1.59677 WP_003402923.1.59722 WP_003402923.1.59727 WP_003402923.1.59732 WP_003402923.1.59738 WP_003402923.1.59750 WP_003402923.1.59757 WP_003402923.1.59761 WP_003402923.1.59808 WP_003402923.1.59850 WP_003402923.1.59856 WP_003402923.1.59860 WP_003402923.1.59861 WP_003402923.1.5987 WP_003402923.1.59878 WP_003402923.1.59888 WP_003402923.1.5996 WP_003402923.1.59961 WP_003402923.1.59974 WP_003402923.1.6000 WP_003402923.1.60007 WP_003402923.1.60016 WP_003402923.1.6003 WP_003402923.1.60047 WP_003402923.1.6007 WP_003402923.1.60091 WP_003402923.1.60121 WP_003402923.1.60125 WP_003402923.1.60135 WP_003402923.1.60139 WP_003402923.1.60152 WP_003402923.1.60171 WP_003402923.1.60197 WP_003402923.1.6020 WP_003402923.1.60205 WP_003402923.1.60207 WP_003402923.1.60215 WP_003402923.1.60217 WP_003402923.1.60267 WP_003402923.1.60288 WP_003402923.1.60291 WP_003402923.1.60301 WP_003402923.1.60305 WP_003402923.1.60312 WP_003402923.1.60313 WP_003402923.1.60314 WP_003402923.1.60367 WP_003402923.1.60376 WP_003402923.1.60403 WP_003402923.1.60413 WP_003402923.1.60421 WP_003402923.1.60451 WP_003402923.1.60460 WP_003402923.1.60479 WP_003402923.1.60487 WP_003402923.1.60512 WP_003402923.1.60573 WP_003402923.1.60583 WP_003402923.1.60632 WP_003402923.1.60657 WP_003402923.1.60687 WP_003402923.1.60689 WP_003402923.1.60727 WP_003402923.1.60738 WP_003402923.1.60763 WP_003402923.1.6077 WP_003402923.1.60791 WP_003402923.1.60834 WP_003402923.1.60870 WP_003402923.1.60878 WP_003402923.1.60879 WP_003402923.1.60913 WP_003402923.1.60978 WP_003402923.1.61001 WP_003402923.1.61012 WP_003402923.1.61014 WP_003402923.1.61015 WP_003402923.1.61037 WP_003402923.1.61052 WP_003402923.1.61065 WP_003402923.1.61100 WP_003402923.1.61101 WP_003402923.1.61138 WP_003402923.1.61142 WP_003402923.1.61198 WP_003402923.1.612 WP_003402923.1.61234 WP_003402923.1.61256 WP_003402923.1.61281 WP_003402923.1.61314 WP_003402923.1.61321 WP_003402923.1.61326 WP_003402923.1.61328 WP_003402923.1.61368 WP_003402923.1.61391 WP_003402923.1.61406 WP_003402923.1.61409 WP_003402923.1.61420 WP_003402923.1.61422 WP_003402923.1.61425 WP_003402923.1.61428 WP_003402923.1.61469 WP_003402923.1.61494 WP_003402923.1.61522 WP_003402923.1.61552 WP_003402923.1.61557 WP_003402923.1.61567 WP_003402923.1.61571 WP_003402923.1.61573 WP_003402923.1.61584 WP_003402923.1.61586 WP_003402923.1.61592 WP_003402923.1.6160 WP_003402923.1.61614 WP_003402923.1.6163 WP_003402923.1.61655 WP_003402923.1.61665 WP_003402923.1.61669 WP_003402923.1.61682 WP_003402923.1.61692 WP_003402923.1.61719 WP_003402923.1.61728 WP_003402923.1.61750 WP_003402923.1.61754 WP_003402923.1.61755 WP_003402923.1.61757 WP_003402923.1.61778 WP_003402923.1.6179 WP_003402923.1.61793 WP_003402923.1.61816 WP_003402923.1.61842 WP_003402923.1.61850 WP_003402923.1.61865 WP_003402923.1.61868 WP_003402923.1.61911 WP_003402923.1.61925 WP_003402923.1.61941 WP_003402923.1.61953 WP_003402923.1.61986 WP_003402923.1.61987 WP_003402923.1.61998 WP_003402923.1.62021 WP_003402923.1.62087 WP_003402923.1.62089 WP_003402923.1.62101 WP_003402923.1.62104 WP_003402923.1.6211 WP_003402923.1.62132 WP_003402923.1.62162 WP_003402923.1.62225 WP_003402923.1.62230 WP_003402923.1.62238 WP_003402923.1.62249 WP_003402923.1.62270 WP_003402923.1.62281 WP_003402923.1.62307 WP_003402923.1.6231 WP_003402923.1.62359 WP_003402923.1.62360 WP_003402923.1.62371 WP_003402923.1.62379 WP_003402923.1.62395 WP_003402923.1.62408 WP_003402923.1.62449 WP_003402923.1.62468 WP_003402923.1.6248 WP_003402923.1.62508 WP_003402923.1.62565 WP_003402923.1.62594 WP_003402923.1.62606 WP_003402923.1.62616 WP_003402923.1.62666 WP_003402923.1.62687 WP_003402923.1.62715 WP_003402923.1.62730 WP_003402923.1.62738 WP_003402923.1.62761 WP_003402923.1.62766 WP_003402923.1.62786 WP_003402923.1.62813 WP_003402923.1.62839 WP_003402923.1.62841 WP_003402923.1.62909 WP_003402923.1.62936 WP_003402923.1.6294 WP_003402923.1.6295 WP_003402923.1.62962 WP_003402923.1.63007 WP_003402923.1.63019 WP_003402923.1.63032 WP_003402923.1.63037 WP_003402923.1.63064 WP_003402923.1.63066 WP_003402923.1.63072 WP_003402923.1.6308 WP_003402923.1.63081 WP_003402923.1.63096 WP_003402923.1.63106 WP_003402923.1.6314 WP_003402923.1.63144 WP_003402923.1.63154 WP_003402923.1.63160 WP_003402923.1.63161 WP_003402923.1.63166 WP_003402923.1.63194 WP_003402923.1.6322 WP_003402923.1.63222 WP_003402923.1.63247 WP_003402923.1.6328 WP_003402923.1.63291 WP_003402923.1.63312 WP_003402923.1.63317 WP_003402923.1.63331 WP_003402923.1.63373 WP_003402923.1.63384 WP_003402923.1.63403 WP_003402923.1.63424 WP_003402923.1.63428 WP_003402923.1.6345 WP_003402923.1.63464 WP_003402923.1.63483 WP_003402923.1.63502 WP_003402923.1.63504 WP_003402923.1.63522 WP_003402923.1.63530 WP_003402923.1.63538 WP_003402923.1.63564 WP_003402923.1.63567 WP_003402923.1.63596 WP_003402923.1.63600 WP_003402923.1.63623 WP_003402923.1.63625 WP_003402923.1.63627 WP_003402923.1.63654 WP_003402923.1.63662 WP_003402923.1.63711 WP_003402923.1.63734 WP_003402923.1.63807 WP_003402923.1.63819 WP_003402923.1.63844 WP_003402923.1.63888 WP_003402923.1.63913 WP_003402923.1.63915 WP_003402923.1.63918 WP_003402923.1.63961 WP_003402923.1.63970 WP_003402923.1.64000 WP_003402923.1.64027 WP_003402923.1.64058 WP_003402923.1.64065 WP_003402923.1.6407 WP_003402923.1.64082 WP_003402923.1.64091 WP_003402923.1.64102 WP_003402923.1.64104 WP_003402923.1.64119 WP_003402923.1.64169 WP_003402923.1.64219 WP_003402923.1.6422 WP_003402923.1.64222 WP_003402923.1.64223 WP_003402923.1.64228 WP_003402923.1.64235 WP_003402923.1.64249 WP_003402923.1.6427 WP_003402923.1.64278 WP_003402923.1.64287 WP_003402923.1.64414 WP_003402923.1.64419 WP_003402923.1.6443 WP_003402923.1.64463 WP_003402923.1.64480 WP_003402923.1.64497 WP_003402923.1.64506 WP_003402923.1.64511 WP_003402923.1.64513 WP_003402923.1.64514 WP_003402923.1.64515 WP_003402923.1.64522 WP_003402923.1.64526 WP_003402923.1.64543 WP_003402923.1.6456 WP_003402923.1.64567 WP_003402923.1.64588 WP_003402923.1.64589 WP_003402923.1.64594 WP_003402923.1.64595 WP_003402923.1.64608 WP_003402923.1.64619 WP_003402923.1.64629 WP_003402923.1.6464 WP_003402923.1.64664 WP_003402923.1.64669 WP_003402923.1.64672 WP_003402923.1.64680 WP_003402923.1.64682 WP_003402923.1.64727 WP_003402923.1.64729 WP_003402923.1.64774 WP_003402923.1.64776 WP_003402923.1.64802 WP_003402923.1.64832 WP_003402923.1.6486 WP_003402923.1.64870 WP_003402923.1.64898 WP_003402923.1.64922 WP_003402923.1.64924 WP_003402923.1.6493 WP_003402923.1.64937 WP_003402923.1.64941 WP_003402923.1.64966 WP_003402923.1.64973 WP_003402923.1.65001 WP_003402923.1.65026 WP_003402923.1.65053 WP_003402923.1.65070 WP_003402923.1.65079 WP_003402923.1.65102 WP_003402923.1.65157 WP_003402923.1.65181 WP_003402923.1.65212 WP_003402923.1.65229 WP_003402923.1.6523 WP_003402923.1.65253 WP_003402923.1.65289 WP_003402923.1.65291 WP_003402923.1.65315 WP_003402923.1.65329 WP_003402923.1.65359 WP_003402923.1.6536 WP_003402923.1.65374 WP_003402923.1.65414 WP_003402923.1.65416 WP_003402923.1.65433 WP_003402923.1.65455 WP_003402923.1.65467 WP_003402923.1.65488 WP_003402923.1.65529 WP_003402923.1.65539 WP_003402923.1.65583 WP_003402923.1.65612 WP_003402923.1.65623 WP_003402923.1.65635 WP_003402923.1.65637 WP_003402923.1.65648 WP_003402923.1.65683 WP_003402923.1.65686 WP_003402923.1.65688 WP_003402923.1.65707 WP_003402923.1.65733 WP_003402923.1.65746 WP_003402923.1.65747 WP_003402923.1.65759 WP_003402923.1.65816 WP_003402923.1.65830 WP_003402923.1.65858 WP_003402923.1.65862 WP_003402923.1.65869 WP_003402923.1.65893 WP_003402923.1.65929 WP_003402923.1.65932 WP_003402923.1.65958 WP_003402923.1.65974 WP_003402923.1.66004 WP_003402923.1.66013 WP_003402923.1.6606 WP_003402923.1.66089 WP_003402923.1.66149 WP_003402923.1.66151 WP_003402923.1.66276 WP_003402923.1.66293 WP_003402923.1.66297 WP_003402923.1.66323 WP_003402923.1.66325 WP_003402923.1.6633 WP_003402923.1.66334 WP_003402923.1.66355 WP_003402923.1.66367 WP_003402923.1.66394 WP_003402923.1.66396 WP_003402923.1.66451 WP_003402923.1.66455 WP_003402923.1.66457 WP_003402923.1.66460 WP_003402923.1.66464 WP_003402923.1.66466 WP_003402923.1.66487 WP_003402923.1.66504 WP_003402923.1.66544 WP_003402923.1.66558 WP_003402923.1.66580 WP_003402923.1.66582 WP_003402923.1.66612 WP_003402923.1.66615 WP_003402923.1.66617 WP_003402923.1.66635 WP_003402923.1.66656 WP_003402923.1.66663 WP_003402923.1.66675 WP_003402923.1.66715 WP_003402923.1.66718 WP_003402923.1.66762 WP_003402923.1.66776 WP_003402923.1.66808 WP_003402923.1.66817 WP_003402923.1.66819 WP_003402923.1.66826 WP_003402923.1.66830 WP_003402923.1.66868 WP_003402923.1.66878 WP_003402923.1.66880 WP_003402923.1.66893 WP_003402923.1.66961 WP_003402923.1.67005 WP_003402923.1.6704 WP_003402923.1.67044 WP_003402923.1.67061 WP_003402923.1.67089 WP_003402923.1.67098 WP_003402923.1.67146 WP_003402923.1.67170 WP_003402923.1.67197 WP_003402923.1.67198 WP_003402923.1.6720 WP_003402923.1.67218 WP_003402923.1.67220 WP_003402923.1.67225 WP_003402923.1.67231 WP_003402923.1.6724 WP_003402923.1.67257 WP_003402923.1.67298 WP_003402923.1.67307 WP_003402923.1.67324 WP_003402923.1.67332 WP_003402923.1.67346 WP_003402923.1.67354 WP_003402923.1.67360 WP_003402923.1.67381 WP_003402923.1.67396 WP_003402923.1.67417 WP_003402923.1.67422 WP_003402923.1.67453 WP_003402923.1.67459 WP_003402923.1.6746 WP_003402923.1.67473 WP_003402923.1.67481 WP_003402923.1.67482 WP_003402923.1.67496 WP_003402923.1.67499 WP_003402923.1.67516 WP_003402923.1.67523 WP_003402923.1.67536 WP_003402923.1.67575 WP_003402923.1.67587 WP_003402923.1.67598 WP_003402923.1.67600 WP_003402923.1.67602 WP_003402923.1.67630 WP_003402923.1.67679 WP_003402923.1.67692 WP_003402923.1.67744 WP_003402923.1.6775 WP_003402923.1.67750 WP_003402923.1.6777 WP_003402923.1.67809 WP_003402923.1.67816 WP_003402923.1.67844 WP_003402923.1.67848 WP_003402923.1.67870 WP_003402923.1.67888 WP_003402923.1.67915 WP_003402923.1.67945 WP_003402923.1.67949 WP_003402923.1.67980 WP_003402923.1.67982 WP_003402923.1.68022 WP_003402923.1.68029 WP_003402923.1.68037 WP_003402923.1.68038 WP_003402923.1.68045 WP_003402923.1.68057 WP_003402923.1.68083 WP_003402923.1.68088 WP_003402923.1.68106 WP_003402923.1.68110 WP_003402923.1.68153 WP_003402923.1.68164 WP_003402923.1.68169 WP_003402923.1.68193 WP_003402923.1.68212 WP_003402923.1.68227 WP_003402923.1.68243 WP_003402923.1.6825 WP_003402923.1.68297 WP_003402923.1.68309 WP_003402923.1.68325 WP_003402923.1.68329 WP_003402923.1.68340 WP_003402923.1.68384 WP_003402923.1.68388 WP_003402923.1.68429 WP_003402923.1.6843 WP_003402923.1.68433 WP_003402923.1.68465 WP_003402923.1.68484 WP_003402923.1.68518 WP_003402923.1.68569 WP_003402923.1.68576 WP_003402923.1.68580 WP_003402923.1.68586 WP_003402923.1.68623 WP_003402923.1.68624 WP_003402923.1.68637 WP_003402923.1.68646 WP_003402923.1.68667 WP_003402923.1.68669 WP_003402923.1.68672 WP_003402923.1.68684 WP_003402923.1.68704 WP_003402923.1.68708 WP_003402923.1.6872 WP_003402923.1.68730 WP_003402923.1.68734 WP_003402923.1.68748 WP_003402923.1.68754 WP_003402923.1.6876 WP_003402923.1.68761 WP_003402923.1.68763 WP_003402923.1.68766 WP_003402923.1.68774 WP_003402923.1.68796 WP_003402923.1.68824 WP_003402923.1.68832 WP_003402923.1.68833 WP_003402923.1.68841 WP_003402923.1.68859 WP_003402923.1.68876 WP_003402923.1.68906 WP_003402923.1.68916 WP_003402923.1.68945 WP_003402923.1.6896 WP_003402923.1.68981 WP_003402923.1.68984 WP_003402923.1.68997 WP_003402923.1.69008 WP_003402923.1.69076 WP_003402923.1.69079 WP_003402923.1.6908 WP_003402923.1.69082 WP_003402923.1.69178 WP_003402923.1.69181 WP_003402923.1.69208 WP_003402923.1.69231 WP_003402923.1.69256 WP_003402923.1.69311 WP_003402923.1.69315 WP_003402923.1.69322 WP_003402923.1.69342 WP_003402923.1.6935 WP_003402923.1.6936 WP_003402923.1.69369 WP_003402923.1.69374 WP_003402923.1.69398 WP_003402923.1.69401 WP_003402923.1.69426 WP_003402923.1.69427 WP_003402923.1.69429 WP_003402923.1.6949 WP_003402923.1.6951 WP_003402923.1.69511 WP_003402923.1.69526 WP_003402923.1.69528 WP_003402923.1.69547 WP_003402923.1.69573 WP_003402923.1.69581 WP_003402923.1.6960 WP_003402923.1.69617 WP_003402923.1.69634 WP_003402923.1.69647 WP_003402923.1.69659 WP_003402923.1.69673 WP_003402923.1.69682 WP_003402923.1.69684 WP_003402923.1.69686 WP_003402923.1.69707 WP_003402923.1.69709 WP_003402923.1.69723 WP_003402923.1.69736 WP_003402923.1.69778 WP_003402923.1.69800 WP_003402923.1.69802 WP_003402923.1.69845 WP_003402923.1.69870 WP_003402923.1.69873 WP_003402923.1.69898 WP_003402923.1.69913 WP_003402923.1.69925 WP_003402923.1.69931 WP_003402923.1.69938 WP_003402923.1.69955 WP_003402923.1.69957 WP_003402923.1.69981 WP_003402923.1.69990 WP_003402923.1.70 WP_003402923.1.70000 WP_003402923.1.70017 WP_003402923.1.70032 WP_003402923.1.70055 WP_003402923.1.70062 WP_003402923.1.70072 WP_003402923.1.70131 WP_003402923.1.70132 WP_003402923.1.7022 WP_003402923.1.70227 WP_003402923.1.70255 WP_003402923.1.70271 WP_003402923.1.70274 WP_003402923.1.7029 WP_003402923.1.70325 WP_003402923.1.70328 WP_003402923.1.70356 WP_003402923.1.70364 WP_003402923.1.70368 WP_003402923.1.70369 WP_003402923.1.70418 WP_003402923.1.70422 WP_003402923.1.70435 WP_003402923.1.70444 WP_003402923.1.70463 WP_003402923.1.70471 WP_003402923.1.70480 WP_003402923.1.70494 WP_003402923.1.70498 WP_003402923.1.70525 WP_003402923.1.70573 WP_003402923.1.70577 WP_003402923.1.70610 WP_003402923.1.70615 WP_003402923.1.70618 WP_003402923.1.70622 WP_003402923.1.70626 WP_003402923.1.70668 WP_003402923.1.70699 WP_003402923.1.70704 WP_003402923.1.70729 WP_003402923.1.70757 WP_003402923.1.70782 WP_003402923.1.70830 WP_003402923.1.70834 WP_003402923.1.7084 WP_003402923.1.70840 WP_003402923.1.70864 WP_003402923.1.70871 WP_003402923.1.70915 WP_003402923.1.70955 WP_003402923.1.70958 WP_003402923.1.70964 WP_003402923.1.70976 WP_003402923.1.71015 WP_003402923.1.71026 WP_003402923.1.71063 WP_003402923.1.71076 WP_003402923.1.71083 WP_003402923.1.7111 WP_003402923.1.71118 WP_003402923.1.71128 WP_003402923.1.7113 WP_003402923.1.71187 WP_003402923.1.71191 WP_003402923.1.71255 WP_003402923.1.71258 WP_003402923.1.71259 WP_003402923.1.71289 WP_003402923.1.71326 WP_003402923.1.71329 WP_003402923.1.71331 WP_003402923.1.71344 WP_003402923.1.71390 WP_003402923.1.71399 WP_003402923.1.71440 WP_003402923.1.71457 WP_003402923.1.7146 WP_003402923.1.71464 WP_003402923.1.71490 WP_003402923.1.71492 WP_003402923.1.71509 WP_003402923.1.71516 WP_003402923.1.71517 WP_003402923.1.71527 WP_003402923.1.71532 WP_003402923.1.71545 WP_003402923.1.71546 WP_003402923.1.71569 WP_003402923.1.71604 WP_003402923.1.71621 WP_003402923.1.71630 WP_003402923.1.71638 WP_003402923.1.71654 WP_003402923.1.71664 WP_003402923.1.71665 WP_003402923.1.71683 WP_003402923.1.71701 WP_003402923.1.71718 WP_003402923.1.71731 WP_003402923.1.71778 WP_003402923.1.71781 WP_003402923.1.71803 WP_003402923.1.71820 WP_003402923.1.71847 WP_003402923.1.7185 WP_003402923.1.71851 WP_003402923.1.71871 WP_003402923.1.71909 WP_003402923.1.71957 WP_003402923.1.71970 WP_003402923.1.72047 WP_003402923.1.72061 WP_003402923.1.72062 WP_003402923.1.72072 WP_003402923.1.72111 WP_003402923.1.72122 WP_003402923.1.72128 WP_003402923.1.72143 WP_003402923.1.7216 WP_003402923.1.72168 WP_003402923.1.72179 WP_003402923.1.72209 WP_003402923.1.72218 WP_003402923.1.72219 WP_003402923.1.72227 WP_003402923.1.7224 WP_003402923.1.72268 WP_003402923.1.72332 WP_003402923.1.72380 WP_003402923.1.72401 WP_003402923.1.72405 WP_003402923.1.72420 WP_003402923.1.72441 WP_003402923.1.72451 WP_003402923.1.72452 WP_003402923.1.72457 WP_003402923.1.72459 WP_003402923.1.72460 WP_003402923.1.72466 WP_003402923.1.72487 WP_003402923.1.72488 WP_003402923.1.72492 WP_003402923.1.72506 WP_003402923.1.72543 WP_003402923.1.7256 WP_003402923.1.72576 WP_003402923.1.72578 WP_003402923.1.72585 WP_003402923.1.72591 WP_003402923.1.72592 WP_003402923.1.72640 WP_003402923.1.7266 WP_003402923.1.72661 WP_003402923.1.72684 WP_003402923.1.72739 WP_003402923.1.72744 WP_003402923.1.72755 WP_003402923.1.72759 WP_003402923.1.72784 WP_003402923.1.72792 WP_003402923.1.72826 WP_003402923.1.72831 WP_003402923.1.72852 WP_003402923.1.72853 WP_003402923.1.72879 WP_003402923.1.72938 WP_003402923.1.72954 WP_003402923.1.72957 WP_003402923.1.72959 WP_003402923.1.72973 WP_003402923.1.7298 WP_003402923.1.72982 WP_003402923.1.72988 WP_003402923.1.72993 WP_003402923.1.73006 WP_003402923.1.73013 WP_003402923.1.73025 WP_003402923.1.73028 WP_003402923.1.73042 WP_003402923.1.73045 WP_003402923.1.73092 WP_003402923.1.73118 WP_003402923.1.7312 WP_003402923.1.73127 WP_003402923.1.73134 WP_003402923.1.73163 WP_003402923.1.73182 WP_003402923.1.73205 WP_003402923.1.7321 WP_003402923.1.73310 WP_003402923.1.73365 WP_003402923.1.73391 WP_003402923.1.73404 WP_003402923.1.73424 WP_003402923.1.73436 WP_003402923.1.73445 WP_003402923.1.73453 WP_003402923.1.73465 WP_003402923.1.73466 WP_003402923.1.73470 WP_003402923.1.73471 WP_003402923.1.73478 WP_003402923.1.73482 WP_003402923.1.73507 WP_003402923.1.73532 WP_003402923.1.73550 WP_003402923.1.73564 WP_003402923.1.73623 WP_003402923.1.73629 WP_003402923.1.7366 WP_003402923.1.73661 WP_003402923.1.7368 WP_003402923.1.73688 WP_003402923.1.73723 WP_003402923.1.73744 WP_003402923.1.73750 WP_003402923.1.73760 WP_003402923.1.73774 WP_003402923.1.7379 WP_003402923.1.73813 WP_003402923.1.73840 WP_003402923.1.73876 WP_003402923.1.7389 WP_003402923.1.73986 WP_003402923.1.74016 WP_003402923.1.74039 WP_003402923.1.74083 WP_003402923.1.74101 WP_003402923.1.74107 WP_003402923.1.74120 WP_003402923.1.74129 WP_003402923.1.74144 WP_003402923.1.7417 WP_003402923.1.74190 WP_003402923.1.74210 WP_003402923.1.7423 WP_003402923.1.74259 WP_003402923.1.74262 WP_003402923.1.74269 WP_003402923.1.74282 WP_003402923.1.74291 WP_003402923.1.74296 WP_003402923.1.74304 WP_003402923.1.7432 WP_003402923.1.74347 WP_003402923.1.7436 WP_003402923.1.74378 WP_003402923.1.74382 WP_003402923.1.74395 WP_003402923.1.74400 WP_003402923.1.74401 WP_003402923.1.74442 WP_003402923.1.74477 WP_003402923.1.74487 WP_003402923.1.74499 WP_003402923.1.74504 WP_003402923.1.74511 WP_003402923.1.74523 WP_003402923.1.74525 WP_003402923.1.74551 WP_003402923.1.74555 WP_003402923.1.74628 WP_003402923.1.74641 WP_003402923.1.74653 WP_003402923.1.74660 WP_003402923.1.74683 WP_003402923.1.7469 WP_003402923.1.74725 WP_003402923.1.74760 WP_003402923.1.74786 WP_003402923.1.74809 WP_003402923.1.74820 WP_003402923.1.74870 WP_003402923.1.74881 WP_003402923.1.74888 WP_003402923.1.74952 WP_003402923.1.7496 WP_003402923.1.74988 WP_003402923.1.75043 WP_003402923.1.75045 WP_003402923.1.75055 WP_003402923.1.75078 WP_003402923.1.75081 WP_003402923.1.75120 WP_003402923.1.75163 WP_003402923.1.75188 WP_003402923.1.75200 WP_003402923.1.75234 WP_003402923.1.75239 WP_003402923.1.75250 WP_003402923.1.75263 WP_003402923.1.75281 WP_003402923.1.75342 WP_003402923.1.7535 WP_003402923.1.75376 WP_003402923.1.75391 WP_003402923.1.75395 WP_003402923.1.75441 WP_003402923.1.75510 WP_003402923.1.75581 WP_003402923.1.75598 WP_003402923.1.75635 WP_003402923.1.75645 WP_003402923.1.75665 WP_003402923.1.75671 WP_003402923.1.75749 WP_003402923.1.75772 WP_003402923.1.75774 WP_003402923.1.75811 WP_003402923.1.75833 WP_003402923.1.7585 WP_003402923.1.75864 WP_003402923.1.75868 WP_003402923.1.75878 WP_003402923.1.75927 WP_003402923.1.75946 WP_003402923.1.75968 WP_003402923.1.75974 WP_003402923.1.76007 WP_003402923.1.76016 WP_003402923.1.76032 WP_003402923.1.76037 WP_003402923.1.7604 WP_003402923.1.76045 WP_003402923.1.76052 WP_003402923.1.76058 WP_003402923.1.76064 WP_003402923.1.76110 WP_003402923.1.76126 WP_003402923.1.76133 WP_003402923.1.76138 WP_003402923.1.76157 WP_003402923.1.76172 WP_003402923.1.76177 WP_003402923.1.76183 WP_003402923.1.76239 WP_003402923.1.76272 WP_003402923.1.76277 WP_003402923.1.76280 WP_003402923.1.76281 WP_003402923.1.76291 WP_003402923.1.76297 WP_003402923.1.76360 WP_003402923.1.76379 WP_003402923.1.76403 WP_003402923.1.76413 WP_003402923.1.76414 WP_003402923.1.76427 WP_003402923.1.76436 WP_003402923.1.76442 WP_003402923.1.76443 WP_003402923.1.76456 WP_003402923.1.76521 WP_003402923.1.76533 WP_003402923.1.76616 WP_003402923.1.76625 WP_003402923.1.76629 WP_003402923.1.76635 WP_003402923.1.76638 WP_003402923.1.76639 WP_003402923.1.76640 WP_003402923.1.76644 WP_003402923.1.76677 WP_003402923.1.76678 WP_003402923.1.76734 WP_003402923.1.76744 WP_003402923.1.76750 WP_003402923.1.76754 WP_003402923.1.76757 WP_003402923.1.76781 WP_003402923.1.76818 WP_003402923.1.76824 WP_003402923.1.76835 WP_003402923.1.76873 WP_003402923.1.76881 WP_003402923.1.76888 WP_003402923.1.76900 WP_003402923.1.7691 WP_003402923.1.76947 WP_003402923.1.76954 WP_003402923.1.76955 WP_003402923.1.76963 WP_003402923.1.76976 WP_003402923.1.770 WP_003402923.1.77000 WP_003402923.1.77008 WP_003402923.1.77021 WP_003402923.1.77056 WP_003402923.1.77065 WP_003402923.1.77075 WP_003402923.1.77093 WP_003402923.1.77115 WP_003402923.1.77118 WP_003402923.1.77125 WP_003402923.1.77141 WP_003402923.1.77142 WP_003402923.1.77166 WP_003402923.1.77250 WP_003402923.1.77252 WP_003402923.1.77260 WP_003402923.1.77266 WP_003402923.1.77285 WP_003402923.1.77312 WP_003402923.1.77348 WP_003402923.1.77351 WP_003402923.1.77352 WP_003402923.1.77361 WP_003402923.1.774 WP_003402923.1.7740 WP_003402923.1.77404 WP_003402923.1.77425 WP_003402923.1.77463 WP_003402923.1.77474 WP_003402923.1.7748 WP_003402923.1.77484 WP_003402923.1.77491 WP_003402923.1.77499 WP_003402923.1.77510 WP_003402923.1.77530 WP_003402923.1.77554 WP_003402923.1.77559 WP_003402923.1.77599 WP_003402923.1.77605 WP_003402923.1.7762 WP_003402923.1.77627 WP_003402923.1.77649 WP_003402923.1.77654 WP_003402923.1.7766 WP_003402923.1.77667 WP_003402923.1.77704 WP_003402923.1.77706 WP_003402923.1.77726 WP_003402923.1.77774 WP_003402923.1.7778 WP_003402923.1.77790 WP_003402923.1.77809 WP_003402923.1.77820 WP_003402923.1.77843 WP_003402923.1.77855 WP_003402923.1.77865 WP_003402923.1.77868 WP_003402923.1.77879 WP_003402923.1.77890 WP_003402923.1.77909 WP_003402923.1.77911 WP_003402923.1.77931 WP_003402923.1.77984 WP_003402923.1.78020 WP_003402923.1.78024 WP_003402923.1.78075 WP_003402923.1.78084 WP_003402923.1.78086 WP_003402923.1.78098 WP_003402923.1.78105 WP_003402923.1.78113 WP_003402923.1.78136 WP_003402923.1.78162 WP_003402923.1.7817 WP_003402923.1.78200 WP_003402923.1.78216 WP_003402923.1.78236 WP_003402923.1.78238 WP_003402923.1.78322 WP_003402923.1.78338 WP_003402923.1.7836 WP_003402923.1.78360 WP_003402923.1.78386 WP_003402923.1.78429 WP_003402923.1.78435 WP_003402923.1.7844 WP_003402923.1.78459 WP_003402923.1.78488 WP_003402923.1.7849 WP_003402923.1.78499 WP_003402923.1.785 WP_003402923.1.78516 WP_003402923.1.78524 WP_003402923.1.78526 WP_003402923.1.78538 WP_003402923.1.78544 WP_003402923.1.78545 WP_003402923.1.78547 WP_003402923.1.78574 WP_003402923.1.78580 WP_003402923.1.7860 WP_003402923.1.78620 WP_003402923.1.78646 WP_003402923.1.78648 WP_003402923.1.78649 WP_003402923.1.78655 WP_003402923.1.78657 WP_003402923.1.78659 WP_003402923.1.7869 WP_003402923.1.78692 WP_003402923.1.78760 WP_003402923.1.78766 WP_003402923.1.78776 WP_003402923.1.78778 WP_003402923.1.78784 WP_003402923.1.78788 WP_003402923.1.78790 WP_003402923.1.78793 WP_003402923.1.78848 WP_003402923.1.78860 WP_003402923.1.7887 WP_003402923.1.78884 WP_003402923.1.78932 WP_003402923.1.78969 WP_003402923.1.78977 WP_003402923.1.78980 WP_003402923.1.79005 WP_003402923.1.79016 WP_003402923.1.79033 WP_003402923.1.79064 WP_003402923.1.79066 WP_003402923.1.79068 WP_003402923.1.79077 WP_003402923.1.79095 WP_003402923.1.79112 WP_003402923.1.79122 WP_003402923.1.79145 WP_003402923.1.79152 WP_003402923.1.79163 WP_003402923.1.79182 WP_003402923.1.79198 WP_003402923.1.79213 WP_003402923.1.79218 WP_003402923.1.79268 WP_003402923.1.79273 WP_003402923.1.79278 WP_003402923.1.79290 WP_003402923.1.79319 WP_003402923.1.79325 WP_003402923.1.79326 WP_003402923.1.79330 WP_003402923.1.79339 WP_003402923.1.79394 WP_003402923.1.79399 WP_003402923.1.79413 WP_003402923.1.79422 WP_003402923.1.79445 WP_003402923.1.79447 WP_003402923.1.79455 WP_003402923.1.79471 WP_003402923.1.79480 WP_003402923.1.79482 WP_003402923.1.79488 WP_003402923.1.79500 WP_003402923.1.79502 WP_003402923.1.79508 WP_003402923.1.79514 WP_003402923.1.79561 WP_003402923.1.79565 WP_003402923.1.79578 WP_003402923.1.79588 WP_003402923.1.79598 WP_003402923.1.79615 WP_003402923.1.79684 WP_003402923.1.79698 WP_003402923.1.797 WP_003402923.1.79744 WP_003402923.1.79784 WP_003402923.1.79802 WP_003402923.1.79819 WP_003402923.1.79826 WP_003402923.1.79828 WP_003402923.1.79851 WP_003402923.1.79853 WP_003402923.1.79863 WP_003402923.1.79881 WP_003402923.1.79885 WP_003402923.1.79898 WP_003402923.1.7990 WP_003402923.1.79900 WP_003402923.1.79913 WP_003402923.1.79918 WP_003402923.1.79947 WP_003402923.1.79948 WP_003402923.1.7995 WP_003402923.1.7997 WP_003402923.1.80004 WP_003402923.1.80015 WP_003402923.1.80022 WP_003402923.1.80030 WP_003402923.1.80054 WP_003402923.1.80084 WP_003402923.1.80099 WP_003402923.1.80129 WP_003402923.1.80177 WP_003402923.1.80234 WP_003402923.1.8026 WP_003402923.1.80275 WP_003402923.1.8029 WP_003402923.1.80299 WP_003402923.1.80304 WP_003402923.1.80326 WP_003402923.1.80351 WP_003402923.1.8037 WP_003402923.1.80370 WP_003402923.1.80387 WP_003402923.1.80399 WP_003402923.1.8044 WP_003402923.1.80451 WP_003402923.1.80458 WP_003402923.1.80461 WP_003402923.1.80490 WP_003402923.1.80503 WP_003402923.1.80507 WP_003402923.1.80552 WP_003402923.1.80576 WP_003402923.1.80599 WP_003402923.1.8060 WP_003402923.1.80624 WP_003402923.1.80636 WP_003402923.1.80673 WP_003402923.1.80711 WP_003402923.1.80714 WP_003402923.1.80743 WP_003402923.1.80784 WP_003402923.1.80815 WP_003402923.1.80853 WP_003402923.1.80918 WP_003402923.1.8093 WP_003402923.1.80967 WP_003402923.1.8097 WP_003402923.1.80988 WP_003402923.1.81007 WP_003402923.1.81013 WP_003402923.1.8105 WP_003402923.1.81059 WP_003402923.1.81063 WP_003402923.1.81066 WP_003402923.1.81075 WP_003402923.1.81091 WP_003402923.1.81119 WP_003402923.1.81125 WP_003402923.1.81136 WP_003402923.1.8114 WP_003402923.1.81189 WP_003402923.1.81192 WP_003402923.1.812 WP_003402923.1.81230 WP_003402923.1.81249 WP_003402923.1.81250 WP_003402923.1.81264 WP_003402923.1.8128 WP_003402923.1.81287 WP_003402923.1.81297 WP_003402923.1.8138 WP_003402923.1.81407 WP_003402923.1.8143 WP_003402923.1.81439 WP_003402923.1.81465 WP_003402923.1.81505 WP_003402923.1.81529 WP_003402923.1.81538 WP_003402923.1.81541 WP_003402923.1.81560 WP_003402923.1.81561 WP_003402923.1.81567 WP_003402923.1.81583 WP_003402923.1.81686 WP_003402923.1.81712 WP_003402923.1.81720 WP_003402923.1.81731 WP_003402923.1.81774 WP_003402923.1.81788 WP_003402923.1.81809 WP_003402923.1.81820 WP_003402923.1.81850 WP_003402923.1.81883 WP_003402923.1.81891 WP_003402923.1.81911 WP_003402923.1.81918 WP_003402923.1.82011 WP_003402923.1.82048 WP_003402923.1.82069 WP_003402923.1.82071 WP_003402923.1.82108 WP_003402923.1.82136 WP_003402923.1.82142 WP_003402923.1.8215 WP_003402923.1.82158 WP_003402923.1.8217 WP_003402923.1.82209 WP_003402923.1.82210 WP_003402923.1.82228 WP_003402923.1.82236 WP_003402923.1.82251 WP_003402923.1.82271 WP_003402923.1.82305 WP_003402923.1.82307 WP_003402923.1.82309 WP_003402923.1.82317 WP_003402923.1.8232 WP_003402923.1.82346 WP_003402923.1.82374 WP_003402923.1.82385 WP_003402923.1.82429 WP_003402923.1.82460 WP_003402923.1.82462 WP_003402923.1.82483 WP_003402923.1.82494 WP_003402923.1.82531 WP_003402923.1.82546 WP_003402923.1.82547 WP_003402923.1.82549 WP_003402923.1.82577 WP_003402923.1.82592 WP_003402923.1.82597 WP_003402923.1.82598 WP_003402923.1.82625 WP_003402923.1.82642 WP_003402923.1.82651 WP_003402923.1.82653 WP_003402923.1.82681 WP_003402923.1.82685 WP_003402923.1.8271 WP_003402923.1.82712 WP_003402923.1.8273 WP_003402923.1.82743 WP_003402923.1.82757 WP_003402923.1.82774 WP_003402923.1.82803 WP_003402923.1.82836 WP_003402923.1.82860 WP_003402923.1.82871 WP_003402923.1.82892 WP_003402923.1.82935 WP_003402923.1.82957 WP_003402923.1.82973 WP_003402923.1.82981 WP_003402923.1.82983 WP_003402923.1.83004 WP_003402923.1.83009 WP_003402923.1.83044 WP_003402923.1.83065 WP_003402923.1.83074 WP_003402923.1.83110 WP_003402923.1.83146 WP_003402923.1.83149 WP_003402923.1.83159 WP_003402923.1.8317 WP_003402923.1.83173 WP_003402923.1.83181 WP_003402923.1.83182 WP_003402923.1.83191 WP_003402923.1.83197 WP_003402923.1.83212 WP_003402923.1.8326 WP_003402923.1.83262 WP_003402923.1.83268 WP_003402923.1.83273 WP_003402923.1.83309 WP_003402923.1.83332 WP_003402923.1.83334 WP_003402923.1.83341 WP_003402923.1.83349 WP_003402923.1.8335 WP_003402923.1.83353 WP_003402923.1.83367 WP_003402923.1.83380 WP_003402923.1.83381 WP_003402923.1.83389 WP_003402923.1.83408 WP_003402923.1.83409 WP_003402923.1.83435 WP_003402923.1.83470 WP_003402923.1.83524 WP_003402923.1.83526 WP_003402923.1.8358 WP_003402923.1.83589 WP_003402923.1.83601 WP_003402923.1.83611 WP_003402923.1.83638 WP_003402923.1.83648 WP_003402923.1.83656 WP_003402923.1.83667 WP_003402923.1.83689 WP_003402923.1.83692 WP_003402923.1.83705 WP_003402923.1.83766 WP_003402923.1.83793 WP_003402923.1.83794 WP_003402923.1.83802 WP_003402923.1.83805 WP_003402923.1.83839 WP_003402923.1.83842 WP_003402923.1.83850 WP_003402923.1.83861 WP_003402923.1.83884 WP_003402923.1.83920 WP_003402923.1.83929 WP_003402923.1.83930 WP_003402923.1.83975 WP_003402923.1.83991 WP_003402923.1.8400 WP_003402923.1.84027 WP_003402923.1.8404 WP_003402923.1.84057 WP_003402923.1.84070 WP_003402923.1.8409 WP_003402923.1.84112 WP_003402923.1.84146 WP_003402923.1.8415 WP_003402923.1.84176 WP_003402923.1.84186 WP_003402923.1.84192 WP_003402923.1.84228 WP_003402923.1.8424 WP_003402923.1.84244 WP_003402923.1.84259 WP_003402923.1.8426 WP_003402923.1.84277 WP_003402923.1.84287 WP_003402923.1.8434 WP_003402923.1.84388 WP_003402923.1.84408 WP_003402923.1.84409 WP_003402923.1.84438 WP_003402923.1.84460 WP_003402923.1.84488 WP_003402923.1.84504 WP_003402923.1.84525 WP_003402923.1.84620 WP_003402923.1.84623 WP_003402923.1.84641 WP_003402923.1.84655 WP_003402923.1.84666 WP_003402923.1.84670 WP_003402923.1.84739 WP_003402923.1.84748 WP_003402923.1.84766 WP_003402923.1.84772 WP_003402923.1.84774 WP_003402923.1.848 WP_003402923.1.84812 WP_003402923.1.84836 WP_003402923.1.84839 WP_003402923.1.84846 WP_003402923.1.84873 WP_003402923.1.84911 WP_003402923.1.84938 WP_003402923.1.84968 WP_003402923.1.84973 WP_003402923.1.84981 WP_003402923.1.84985 WP_003402923.1.8503 WP_003402923.1.85038 WP_003402923.1.85041 WP_003402923.1.85043 WP_003402923.1.8505 WP_003402923.1.85074 WP_003402923.1.8509 WP_003402923.1.8512 WP_003402923.1.85148 WP_003402923.1.8518 WP_003402923.1.8522 WP_003402923.1.85242 WP_003402923.1.85276 WP_003402923.1.85281 WP_003402923.1.85284 WP_003402923.1.85314 WP_003402923.1.85319 WP_003402923.1.85330 WP_003402923.1.85341 WP_003402923.1.85346 WP_003402923.1.8535 WP_003402923.1.85363 WP_003402923.1.85371 WP_003402923.1.85377 WP_003402923.1.85387 WP_003402923.1.85399 WP_003402923.1.85458 WP_003402923.1.8546 WP_003402923.1.85464 WP_003402923.1.85478 WP_003402923.1.85480 WP_003402923.1.85488 WP_003402923.1.85495 WP_003402923.1.85551 WP_003402923.1.85557 WP_003402923.1.85577 WP_003402923.1.85597 WP_003402923.1.85599 WP_003402923.1.85610 WP_003402923.1.8563 WP_003402923.1.85648 WP_003402923.1.85679 WP_003402923.1.85704 WP_003402923.1.85717 WP_003402923.1.85727 WP_003402923.1.85737 WP_003402923.1.85763 WP_003402923.1.85808 WP_003402923.1.85819 WP_003402923.1.85820 WP_003402923.1.85823 WP_003402923.1.85832 WP_003402923.1.8586 WP_003402923.1.85872 WP_003402923.1.85894 WP_003402923.1.85909 WP_003402923.1.85913 WP_003402923.1.85953 WP_003402923.1.85986 WP_003402923.1.86000 WP_003402923.1.86024 WP_003402923.1.86025 WP_003402923.1.86032 WP_003402923.1.86048 WP_003402923.1.86052 WP_003402923.1.86067 WP_003402923.1.86103 WP_003402923.1.86122 WP_003402923.1.86124 WP_003402923.1.86160 WP_003402923.1.86164 WP_003402923.1.86168 WP_003402923.1.86190 WP_003402923.1.86204 WP_003402923.1.86208 WP_003402923.1.86249 WP_003402923.1.86260 WP_003402923.1.86290 WP_003402923.1.863 WP_003402923.1.86327 WP_003402923.1.86334 WP_003402923.1.86337 WP_003402923.1.86368 WP_003402923.1.86377 WP_003402923.1.86425 WP_003402923.1.86459 WP_003402923.1.8649 WP_003402923.1.86499 WP_003402923.1.86520 WP_003402923.1.86561 WP_003402923.1.86568 WP_003402923.1.86575 WP_003402923.1.86584 WP_003402923.1.86605 WP_003402923.1.86626 WP_003402923.1.86648 WP_003402923.1.8666 WP_003402923.1.86684 WP_003402923.1.86696 WP_003402923.1.86705 WP_003402923.1.86718 WP_003402923.1.86725 WP_003402923.1.86757 WP_003402923.1.86766 WP_003402923.1.86801 WP_003402923.1.86814 WP_003402923.1.86820 WP_003402923.1.86825 WP_003402923.1.86834 WP_003402923.1.8685 WP_003402923.1.86851 WP_003402923.1.86855 WP_003402923.1.86867 WP_003402923.1.86877 WP_003402923.1.86883 WP_003402923.1.8689 WP_003402923.1.86892 WP_003402923.1.86933 WP_003402923.1.86941 WP_003402923.1.86950 WP_003402923.1.86962 WP_003402923.1.86963 WP_003402923.1.86979 WP_003402923.1.8700 WP_003402923.1.87001 WP_003402923.1.87002 WP_003402923.1.87031 WP_003402923.1.87116 WP_003402923.1.87117 WP_003402923.1.8714 WP_003402923.1.87162 WP_003402923.1.87178 WP_003402923.1.87191 WP_003402923.1.87201 WP_003402923.1.87209 WP_003402923.1.87240 WP_003402923.1.87266 WP_003402923.1.87273 WP_003402923.1.87275 WP_003402923.1.8733 WP_003402923.1.87345 WP_003402923.1.87369 WP_003402923.1.8737 WP_003402923.1.87401 WP_003402923.1.87404 WP_003402923.1.87406 WP_003402923.1.87409 WP_003402923.1.87444 WP_003402923.1.87446 WP_003402923.1.87459 WP_003402923.1.87472 WP_003402923.1.87489 WP_003402923.1.87494 WP_003402923.1.87496 WP_003402923.1.87582 WP_003402923.1.87588 WP_003402923.1.87617 WP_003402923.1.87619 WP_003402923.1.87620 WP_003402923.1.87634 WP_003402923.1.87643 WP_003402923.1.8765 WP_003402923.1.87650 WP_003402923.1.87654 WP_003402923.1.87658 WP_003402923.1.87665 WP_003402923.1.87676 WP_003402923.1.87677 WP_003402923.1.87684 WP_003402923.1.87692 WP_003402923.1.87707 WP_003402923.1.87732 WP_003402923.1.87784 WP_003402923.1.87796 WP_003402923.1.87809 WP_003402923.1.87817 WP_003402923.1.87827 WP_003402923.1.87831 WP_003402923.1.87835 WP_003402923.1.87837 WP_003402923.1.87866 WP_003402923.1.8789 WP_003402923.1.87911 WP_003402923.1.87924 WP_003402923.1.87951 WP_003402923.1.87956 WP_003402923.1.87991 WP_003402923.1.88 WP_003402923.1.88002 WP_003402923.1.88037 WP_003402923.1.88039 WP_003402923.1.88072 WP_003402923.1.88077 WP_003402923.1.88121 WP_003402923.1.88180 WP_003402923.1.88191 WP_003402923.1.88205 WP_003402923.1.88217 WP_003402923.1.88219 WP_003402923.1.88245 WP_003402923.1.88253 WP_003402923.1.88294 WP_003402923.1.88315 WP_003402923.1.88316 WP_003402923.1.88320 WP_003402923.1.88338 WP_003402923.1.8840 WP_003402923.1.88437 WP_003402923.1.88453 WP_003402923.1.88469 WP_003402923.1.88489 WP_003402923.1.88521 WP_003402923.1.88530 WP_003402923.1.88537 WP_003402923.1.88541 WP_003402923.1.88592 WP_003402923.1.88616 WP_003402923.1.88618 WP_003402923.1.8862 WP_003402923.1.88625 WP_003402923.1.88632 WP_003402923.1.88634 WP_003402923.1.88649 WP_003402923.1.8870 WP_003402923.1.88737 WP_003402923.1.88756 WP_003402923.1.888 WP_003402923.1.88824 WP_003402923.1.88886 WP_003402923.1.88965 WP_003402923.1.88985 WP_003402923.1.8902 WP_003402923.1.89025 WP_003402923.1.89041 WP_003402923.1.89046 WP_003402923.1.89082 WP_003402923.1.89162 WP_003402923.1.8917 WP_003402923.1.89193 WP_003402923.1.89205 WP_003402923.1.89207 WP_003402923.1.89225 WP_003402923.1.8925 WP_003402923.1.89277 WP_003402923.1.89286 WP_003402923.1.89293 WP_003402923.1.89320 WP_003402923.1.8935 WP_003402923.1.89371 WP_003402923.1.89378 WP_003402923.1.89392 WP_003402923.1.89406 WP_003402923.1.8943 WP_003402923.1.89451 WP_003402923.1.89453 WP_003402923.1.89473 WP_003402923.1.89475 WP_003402923.1.89483 WP_003402923.1.895 WP_003402923.1.89513 WP_003402923.1.89517 WP_003402923.1.89522 WP_003402923.1.8954 WP_003402923.1.89543 WP_003402923.1.89567 WP_003402923.1.8957 WP_003402923.1.89572 WP_003402923.1.89589 WP_003402923.1.89607 WP_003402923.1.89613 WP_003402923.1.89625 WP_003402923.1.89648 WP_003402923.1.8967 WP_003402923.1.89670 WP_003402923.1.89676 WP_003402923.1.89729 WP_003402923.1.89739 WP_003402923.1.89762 WP_003402923.1.8977 WP_003402923.1.89802 WP_003402923.1.89808 WP_003402923.1.8982 WP_003402923.1.89829 WP_003402923.1.89831 WP_003402923.1.89844 WP_003402923.1.89849 WP_003402923.1.8989 WP_003402923.1.89901 WP_003402923.1.89903 WP_003402923.1.89909 WP_003402923.1.89922 WP_003402923.1.89926 WP_003402923.1.89963 WP_003402923.1.89971 WP_003402923.1.8998 WP_003402923.1.900 WP_003402923.1.90048 WP_003402923.1.9007 WP_003402923.1.90080 WP_003402923.1.90130 WP_003402923.1.90134 WP_003402923.1.90137 WP_003402923.1.90157 WP_003402923.1.90184 WP_003402923.1.90199 WP_003402923.1.90231 WP_003402923.1.90245 WP_003402923.1.90308 WP_003402923.1.90322 WP_003402923.1.90328 WP_003402923.1.90372 WP_003402923.1.90439 WP_003402923.1.90481 WP_003402923.1.90499 WP_003402923.1.9050 WP_003402923.1.90527 WP_003402923.1.90550 WP_003402923.1.90560 WP_003402923.1.90612 WP_003402923.1.90640 WP_003402923.1.90672 WP_003402923.1.90687 WP_003402923.1.90691 WP_003402923.1.90711 WP_003402923.1.90722 WP_003402923.1.90744 WP_003402923.1.9075 WP_003402923.1.90756 WP_003402923.1.90767 WP_003402923.1.90771 WP_003402923.1.90785 WP_003402923.1.90788 WP_003402923.1.90800 WP_003402923.1.90810 WP_003402923.1.90816 WP_003402923.1.90819 WP_003402923.1.9082 WP_003402923.1.90831 WP_003402923.1.90884 WP_003402923.1.90899 WP_003402923.1.90906 WP_003402923.1.90958 WP_003402923.1.90976 WP_003402923.1.90977 WP_003402923.1.90987 WP_003402923.1.9102 WP_003402923.1.91026 WP_003402923.1.91032 WP_003402923.1.91043 WP_003402923.1.91053 WP_003402923.1.91082 WP_003402923.1.91106 WP_003402923.1.91112 WP_003402923.1.91144 WP_003402923.1.91151 WP_003402923.1.91157 WP_003402923.1.91167 WP_003402923.1.91169 WP_003402923.1.91192 WP_003402923.1.91201 WP_003402923.1.91208 WP_003402923.1.91211 WP_003402923.1.91214 WP_003402923.1.91230 WP_003402923.1.91244 WP_003402923.1.91251 WP_003402923.1.91260 WP_003402923.1.91265 WP_003402923.1.9128 WP_003402923.1.91284 WP_003402923.1.91294 WP_003402923.1.91303 WP_003402923.1.91322 WP_003402923.1.91352 WP_003402923.1.91386 WP_003402923.1.9139 WP_003402923.1.91398 WP_003402923.1.91411 WP_003402923.1.91430 WP_003402923.1.91436 WP_003402923.1.91483 WP_003402923.1.91496 WP_003402923.1.91507 WP_003402923.1.91508 WP_003402923.1.91576 WP_003402923.1.91589 WP_003402923.1.91694 WP_003402923.1.91695 WP_003402923.1.91713 WP_003402923.1.91716 WP_003402923.1.91717 WP_003402923.1.91728 WP_003402923.1.91743 WP_003402923.1.91759 WP_003402923.1.91784 WP_003402923.1.91785 WP_003402923.1.91786 WP_003402923.1.91802 WP_003402923.1.91822 WP_003402923.1.91828 WP_003402923.1.9189 WP_003402923.1.91896 WP_003402923.1.9190 WP_003402923.1.91915 WP_003402923.1.91931 WP_003402923.1.91937 WP_003402923.1.91944 WP_003402923.1.91953 WP_003402923.1.91957 WP_003402923.1.91976 WP_003402923.1.91978 WP_003402923.1.92021 WP_003402923.1.92083 WP_003402923.1.92127 WP_003402923.1.92144 WP_003402923.1.92150 WP_003402923.1.92153 WP_003402923.1.92190 WP_003402923.1.92192 WP_003402923.1.92200 WP_003402923.1.92220 WP_003402923.1.92221 WP_003402923.1.92222 WP_003402923.1.92289 WP_003402923.1.9229 WP_003402923.1.92294 WP_003402923.1.92300 WP_003402923.1.92317 WP_003402923.1.92334 WP_003402923.1.92338 WP_003402923.1.92345 WP_003402923.1.92356 WP_003402923.1.92364 WP_003402923.1.92380 WP_003402923.1.92416 WP_003402923.1.92428 WP_003402923.1.92447 WP_003402923.1.92456 WP_003402923.1.92467 WP_003402923.1.92471 WP_003402923.1.92490 WP_003402923.1.92508 WP_003402923.1.9251 WP_003402923.1.92511 WP_003402923.1.92523 WP_003402923.1.92527 WP_003402923.1.92536 WP_003402923.1.92592 WP_003402923.1.92597 WP_003402923.1.92603 WP_003402923.1.92606 WP_003402923.1.92610 WP_003402923.1.92613 WP_003402923.1.9263 WP_003402923.1.9265 WP_003402923.1.92650 WP_003402923.1.92660 WP_003402923.1.92677 WP_003402923.1.92685 WP_003402923.1.92689 WP_003402923.1.92690 WP_003402923.1.92706 WP_003402923.1.92714 WP_003402923.1.92736 WP_003402923.1.9274 WP_003402923.1.92752 WP_003402923.1.92760 WP_003402923.1.92777 WP_003402923.1.92803 WP_003402923.1.92833 WP_003402923.1.92856 WP_003402923.1.92881 WP_003402923.1.92892 WP_003402923.1.92907 WP_003402923.1.92908 WP_003402923.1.9291 WP_003402923.1.92917 WP_003402923.1.92996 WP_003402923.1.93006 WP_003402923.1.93008 WP_003402923.1.93009 WP_003402923.1.93015 WP_003402923.1.93043 WP_003402923.1.9307 WP_003402923.1.93083 WP_003402923.1.93097 WP_003402923.1.93137 WP_003402923.1.93192 WP_003402923.1.93203 WP_003402923.1.93212 WP_003402923.1.93234 WP_003402923.1.93245 WP_003402923.1.93257 WP_003402923.1.93265 WP_003402923.1.93297 WP_003402923.1.93320 WP_003402923.1.93328 WP_003402923.1.93337 WP_003402923.1.93343 WP_003402923.1.93349 WP_003402923.1.93363 WP_003402923.1.93377 WP_003402923.1.9338 WP_003402923.1.93407 WP_003402923.1.93417 WP_003402923.1.93419 WP_003402923.1.93426 WP_003402923.1.93443 WP_003402923.1.93447 WP_003402923.1.93470 WP_003402923.1.93483 WP_003402923.1.93487 WP_003402923.1.93495 WP_003402923.1.93499 WP_003402923.1.93516 WP_003402923.1.93536 WP_003402923.1.93544 WP_003402923.1.93555 WP_003402923.1.93560 WP_003402923.1.93564 WP_003402923.1.9357 WP_003402923.1.93573 WP_003402923.1.93576 WP_003402923.1.93588 WP_003402923.1.9363 WP_003402923.1.93645 WP_003402923.1.93649 WP_003402923.1.93659 WP_003402923.1.93677 WP_003402923.1.9368 WP_003402923.1.93689 WP_003402923.1.93693 WP_003402923.1.93698 WP_003402923.1.93706 WP_003402923.1.9371 WP_003402923.1.93792 WP_003402923.1.93823 WP_003402923.1.93871 WP_003402923.1.9388 WP_003402923.1.93894 WP_003402923.1.93903 WP_003402923.1.93907 WP_003402923.1.93913 WP_003402923.1.93946 WP_003402923.1.93950 WP_003402923.1.93953 WP_003402923.1.93954 WP_003402923.1.93988 WP_003402923.1.9407 WP_003402923.1.94143 WP_003402923.1.94154 WP_003402923.1.94184 WP_003402923.1.94204 WP_003402923.1.94205 WP_003402923.1.94226 WP_003402923.1.94231 WP_003402923.1.94256 WP_003402923.1.94261 WP_003402923.1.94281 WP_003402923.1.94292 WP_003402923.1.94297 WP_003402923.1.9431 WP_003402923.1.94326 WP_003402923.1.94339 WP_003402923.1.94392 WP_003402923.1.94416 WP_003402923.1.94421 WP_003402923.1.94456 WP_003402923.1.94470 WP_003402923.1.94480 WP_003402923.1.94495 WP_003402923.1.94511 WP_003402923.1.94512 WP_003402923.1.94525 WP_003402923.1.94528 WP_003402923.1.94564 WP_003402923.1.946 WP_003402923.1.94602 WP_003402923.1.94623 WP_003402923.1.9465 WP_003402923.1.94673 WP_003402923.1.94714 WP_003402923.1.94730 WP_003402923.1.94736 WP_003402923.1.94776 WP_003402923.1.9478 WP_003402923.1.94852 WP_003402923.1.94872 WP_003402923.1.9488 WP_003402923.1.94902 WP_003402923.1.94916 WP_003402923.1.94979 WP_003402923.1.94994 WP_003402923.1.94996 WP_003402923.1.94998 WP_003402923.1.95007 WP_003402923.1.95010 WP_003402923.1.95015 WP_003402923.1.95034 WP_003402923.1.95068 WP_003402923.1.95081 WP_003402923.1.95082 WP_003402923.1.9509 WP_003402923.1.95096 WP_003402923.1.95112 WP_003402923.1.95138 WP_003402923.1.95179 WP_003402923.1.95188 WP_003402923.1.95190 WP_003402923.1.95234 WP_003402923.1.95241 WP_003402923.1.95245 WP_003402923.1.95257 WP_003402923.1.95279 WP_003402923.1.9531 WP_003402923.1.95335 WP_003402923.1.95344 WP_003402923.1.9535 WP_003402923.1.95370 WP_003402923.1.95392 WP_003402923.1.95416 WP_003402923.1.95417 WP_003402923.1.95454 WP_003402923.1.95455 WP_003402923.1.95491 WP_003402923.1.95497 WP_003402923.1.95508 WP_003402923.1.95509 WP_003402923.1.95529 WP_003402923.1.95556 WP_003402923.1.95557 WP_003402923.1.95565 WP_003402923.1.95578 WP_003402923.1.95580 WP_003402923.1.95585 WP_003402923.1.95643 WP_003402923.1.95679 WP_003402923.1.95685 WP_003402923.1.957 WP_003402923.1.95724 WP_003402923.1.95727 WP_003402923.1.95735 WP_003402923.1.95758 WP_003402923.1.95772 WP_003402923.1.95797 WP_003402923.1.95839 WP_003402923.1.9585 WP_003402923.1.9590 WP_003402923.1.95902 WP_003402923.1.95908 WP_003402923.1.95924 WP_003402923.1.95926 WP_003402923.1.95953 WP_003402923.1.95958 WP_003402923.1.95964 WP_003402923.1.95973 WP_003402923.1.96006 WP_003402923.1.96036 WP_003402923.1.96062 WP_003402923.1.96065 WP_003402923.1.96098 WP_003402923.1.96146 WP_003402923.1.96166 WP_003402923.1.96171 WP_003402923.1.96182 WP_003402923.1.96204 WP_003402923.1.96230 WP_003402923.1.96235 WP_003402923.1.96242 WP_003402923.1.96245 WP_003402923.1.96254 WP_003402923.1.96259 WP_003402923.1.96286 WP_003402923.1.96313 WP_003402923.1.96318 WP_003402923.1.96345 WP_003402923.1.96360 WP_003402923.1.96373 WP_003402923.1.96456 WP_003402923.1.96486 WP_003402923.1.96569 WP_003402923.1.96573 WP_003402923.1.96575 WP_003402923.1.96576 WP_003402923.1.96611 WP_003402923.1.96621 WP_003402923.1.9667 WP_003402923.1.96681 WP_003402923.1.96726 WP_003402923.1.96733 WP_003402923.1.96742 WP_003402923.1.96754 WP_003402923.1.9678 WP_003402923.1.96832 WP_003402923.1.9685 WP_003402923.1.97008 WP_003402923.1.97009 WP_003402923.1.97056 WP_003402923.1.97084 WP_003402923.1.97087 WP_003402923.1.97096 WP_003402923.1.97099 WP_003402923.1.97108 WP_003402923.1.97113 WP_003402923.1.97122 WP_003402923.1.97127 WP_003402923.1.97129 WP_003402923.1.97136 WP_003402923.1.9716 WP_003402923.1.97176 WP_003402923.1.97222 WP_003402923.1.97223 WP_003402923.1.97237 WP_003402923.1.97242 WP_003402923.1.97270 WP_003402923.1.97283 WP_003402923.1.97296 WP_003402923.1.97321 WP_003402923.1.97325 WP_003402923.1.97330 WP_003402923.1.97366 WP_003402923.1.97376 WP_003402923.1.97380 WP_003402923.1.9739 WP_003402923.1.97462 WP_003402923.1.97517 WP_003402923.1.97519 WP_003402923.1.97535 WP_003402923.1.97540 WP_003402923.1.97545 WP_003402923.1.97546 WP_003402923.1.97550 WP_003402923.1.97577 WP_003402923.1.97584 WP_003402923.1.9759 WP_003402923.1.97591 WP_003402923.1.97596 WP_003402923.1.97609 WP_003402923.1.97618 WP_003402923.1.9763 WP_003402923.1.97669 WP_003402923.1.97673 WP_003402923.1.97700 WP_003402923.1.97701 WP_003402923.1.9773 WP_003402923.1.97730 WP_003402923.1.97740 WP_003402923.1.97751 WP_003402923.1.97754 WP_003402923.1.97797 WP_003402923.1.9782 WP_003402923.1.9784 WP_003402923.1.97888 WP_003402923.1.9790 WP_003402923.1.9795 WP_003402923.1.97951 WP_003402923.1.97958 WP_003402923.1.97966 WP_003402923.1.97977 WP_003402923.1.97979 WP_003402923.1.97995 WP_003402923.1.98018 WP_003402923.1.98034 WP_003402923.1.98052 WP_003402923.1.98071 WP_003402923.1.98072 WP_003402923.1.98113 WP_003402923.1.98114 WP_003402923.1.98128 WP_003402923.1.98181 WP_003402923.1.98188 WP_003402923.1.98189 WP_003402923.1.98213 WP_003402923.1.98225 WP_003402923.1.98291 WP_003402923.1.98335 WP_003402923.1.98350 WP_003402923.1.98395 WP_003402923.1.98412 WP_003402923.1.98441 WP_003402923.1.98443 WP_003402923.1.98462 WP_003402923.1.9848 WP_003402923.1.98482 WP_003402923.1.98486 WP_003402923.1.98488 WP_003402923.1.98503 WP_003402923.1.98516 WP_003402923.1.98536 WP_003402923.1.98541 WP_003402923.1.98566 WP_003402923.1.98576 WP_003402923.1.98590 WP_003402923.1.98594 WP_003402923.1.98599 WP_003402923.1.98629 WP_003402923.1.98645 WP_003402923.1.98646 WP_003402923.1.98649 WP_003402923.1.98656 WP_003402923.1.9867 WP_003402923.1.98674 WP_003402923.1.98697 WP_003402923.1.98701 WP_003402923.1.98739 WP_003402923.1.98749 WP_003402923.1.98765 WP_003402923.1.98770 WP_003402923.1.98777 WP_003402923.1.98778 WP_003402923.1.98802 WP_003402923.1.98838 WP_003402923.1.98850 WP_003402923.1.98906 WP_003402923.1.98935 WP_003402923.1.98948 WP_003402923.1.98953 WP_003402923.1.98984 WP_003402923.1.99000 WP_003402923.1.99030 WP_003402923.1.99037 WP_003402923.1.99055 WP_003402923.1.99062 WP_003402923.1.99086 WP_003402923.1.99115 WP_003402923.1.99117 WP_003402923.1.99161 WP_003402923.1.99176 WP_003402923.1.99205 WP_003402923.1.99211 WP_003402923.1.99216 WP_003402923.1.99222 WP_003402923.1.99251 WP_003402923.1.99269 WP_003402923.1.99294 WP_003402923.1.99312 WP_003402923.1.99315 WP_003402923.1.99316 WP_003402923.1.99322 WP_003402923.1.99328 WP_003402923.1.99365 WP_003402923.1.99368 WP_003402923.1.99379 WP_003402923.1.99396 WP_003402923.1.99402 WP_003402923.1.99404 WP_003402923.1.99419 WP_003402923.1.99438 WP_003402923.1.99460 WP_003402923.1.99468 WP_003402923.1.99473 WP_003402923.1.99513 WP_003402923.1.99529 WP_003402923.1.99548 WP_003402923.1.99572 WP_003402923.1.99575 WP_003402923.1.99578 WP_003402923.1.99605 WP_003402923.1.99609 WP_003402923.1.99617 WP_003402923.1.99635 WP_003402923.1.99650 WP_003402923.1.99672 WP_003402923.1.99701 WP_003402923.1.99711 WP_003402923.1.99716 WP_003402923.1.99740 WP_003402923.1.99745 WP_003402923.1.99749 WP_003402923.1.9976 WP_003402923.1.99798 WP_003402923.1.99817 WP_003402923.1.99832 WP_003402923.1.99847 WP_003402923.1.99852 WP_003402923.1.99886 WP_003402923.1.99897 WP_003402923.1.99899 WP_003402923.1.99915 WP_003402923.1.9993 WP_003402923.1.99982 WP_003402923.1.99991 gi|31791735|ref|NP_854228.1| gi|15607693|ref|NP_215067.1| gi|15839951|ref|NP_334988.1| gi|471336386|ref|YP_007609099.1| gi|386003589|ref|YP_005921868.1| gi|479054499|ref|YP_007350305.1| gi|224988943|ref|YP_002643630.1| gi|378770305|ref|YP_005170038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]