SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 336982.TBFG_11041 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  336982.TBFG_11041
Domain Number 1 Region: 137-418
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.13e-122
Family Enolase 0.0000000397
Further Details:      
 
Domain Number 2 Region: 3-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.12e-51
Family Enolase N-terminal domain-like 0.00000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 336982.TBFG_11041
Sequence length 429
Comment (Mycobacterium tuberculosis F11)
Sequence
MPIIEQVRAREILDSRGNPTVEVEVALIDGTFARAAVPSGASTGEHEAVELRDGGDRYGG
KGVQKAVQAVLDEIGPAVIGLNADDQRLVDQALVDLDGTPDKSRLGGNAILGVSLAVAKA
AADSAELPLFRYVGGPNAHILPVPMMNILNGGAHADTAVDIQEFMVAPIGAPSFVEALRW
GAEVYHALKSVLKKEGLSTGLGDEGGFAPDVAGTTAALDLISRAIESAGLRPGADVALAL
DAAATEFFTDGTGYVFEGTTRTADQMTEFYAGLLGAYPLVSIEDPLSEDDWDGWAALTAS
IGDRVQIVGDDIFVTNPERLEEGIERGVANALLVKVNQIGTLTETLDAVTLAHHGGYRTM
ISHRSGETEDTMIADLAVAIGSGQIKTGAPARSERVAKYNQLLRIEEALGDAARYAGDLA
FPRFACETK
Download sequence
Identical sequences A0A0E8NV14 A0A0H3LBF5 A1QQ97 A5U166 I6XWV0 P9WNL0 P9WNL1
336982.TBFG_11041 419947.MRA_1031 83331.MT1051 83332.Rv1023 gi|15840451|ref|NP_335488.1| gi|197739756|ref|YP_002161070.1| gi|148822232|ref|YP_001286986.1| gi|383306905|ref|YP_005359716.1| gi|392385730|ref|YP_005307359.1| gi|479054979|ref|YP_007350785.1| gi|15608163|ref|NP_215539.1| ISFI215 Rv1023 gi|15608163|ref|NP_215539.1| gi|471336907|ref|YP_007609620.1| NP_215539.1.84033 WP_003898693.1.100087 WP_003898693.1.10015 WP_003898693.1.10022 WP_003898693.1.100286 WP_003898693.1.100309 WP_003898693.1.100318 WP_003898693.1.100338 WP_003898693.1.1004 WP_003898693.1.100401 WP_003898693.1.100459 WP_003898693.1.100552 WP_003898693.1.100581 WP_003898693.1.100600 WP_003898693.1.100625 WP_003898693.1.100671 WP_003898693.1.100677 WP_003898693.1.100757 WP_003898693.1.100772 WP_003898693.1.100812 WP_003898693.1.100845 WP_003898693.1.10090 WP_003898693.1.100918 WP_003898693.1.100935 WP_003898693.1.100992 WP_003898693.1.101 WP_003898693.1.101025 WP_003898693.1.101028 WP_003898693.1.10104 WP_003898693.1.101054 WP_003898693.1.101143 WP_003898693.1.10125 WP_003898693.1.101290 WP_003898693.1.101323 WP_003898693.1.101324 WP_003898693.1.101367 WP_003898693.1.101398 WP_003898693.1.10145 WP_003898693.1.101452 WP_003898693.1.101481 WP_003898693.1.101493 WP_003898693.1.101496 WP_003898693.1.101525 WP_003898693.1.101535 WP_003898693.1.10156 WP_003898693.1.101622 WP_003898693.1.101644 WP_003898693.1.101671 WP_003898693.1.10170 WP_003898693.1.101722 WP_003898693.1.101733 WP_003898693.1.101754 WP_003898693.1.101795 WP_003898693.1.101826 WP_003898693.1.101836 WP_003898693.1.101858 WP_003898693.1.101859 WP_003898693.1.101862 WP_003898693.1.10193 WP_003898693.1.102008 WP_003898693.1.102055 WP_003898693.1.102099 WP_003898693.1.1021 WP_003898693.1.10211 WP_003898693.1.102143 WP_003898693.1.10216 WP_003898693.1.10272 WP_003898693.1.10362 WP_003898693.1.10376 WP_003898693.1.1044 WP_003898693.1.10440 WP_003898693.1.10445 WP_003898693.1.10471 WP_003898693.1.10489 WP_003898693.1.10594 WP_003898693.1.10603 WP_003898693.1.10606 WP_003898693.1.10635 WP_003898693.1.10648 WP_003898693.1.10662 WP_003898693.1.10709 WP_003898693.1.10735 WP_003898693.1.10740 WP_003898693.1.1078 WP_003898693.1.10791 WP_003898693.1.10799 WP_003898693.1.10848 WP_003898693.1.10863 WP_003898693.1.10912 WP_003898693.1.10916 WP_003898693.1.10923 WP_003898693.1.10927 WP_003898693.1.10958 WP_003898693.1.10981 WP_003898693.1.10993 WP_003898693.1.11061 WP_003898693.1.11070 WP_003898693.1.11171 WP_003898693.1.11176 WP_003898693.1.11236 WP_003898693.1.11342 WP_003898693.1.11376 WP_003898693.1.11402 WP_003898693.1.11481 WP_003898693.1.11487 WP_003898693.1.11489 WP_003898693.1.11514 WP_003898693.1.11596 WP_003898693.1.11604 WP_003898693.1.11697 WP_003898693.1.11752 WP_003898693.1.11758 WP_003898693.1.11775 WP_003898693.1.11804 WP_003898693.1.11822 WP_003898693.1.11856 WP_003898693.1.11960 WP_003898693.1.11961 WP_003898693.1.120 WP_003898693.1.12100 WP_003898693.1.12133 WP_003898693.1.12184 WP_003898693.1.12216 WP_003898693.1.12275 WP_003898693.1.12293 WP_003898693.1.123 WP_003898693.1.12327 WP_003898693.1.12338 WP_003898693.1.12372 WP_003898693.1.12389 WP_003898693.1.12406 WP_003898693.1.12421 WP_003898693.1.12446 WP_003898693.1.12464 WP_003898693.1.12479 WP_003898693.1.12523 WP_003898693.1.12526 WP_003898693.1.12611 WP_003898693.1.1267 WP_003898693.1.12672 WP_003898693.1.12768 WP_003898693.1.12794 WP_003898693.1.12854 WP_003898693.1.12871 WP_003898693.1.12901 WP_003898693.1.13028 WP_003898693.1.13086 WP_003898693.1.13087 WP_003898693.1.13163 WP_003898693.1.13249 WP_003898693.1.13282 WP_003898693.1.13296 WP_003898693.1.13298 WP_003898693.1.13312 WP_003898693.1.13313 WP_003898693.1.13321 WP_003898693.1.13370 WP_003898693.1.1338 WP_003898693.1.13433 WP_003898693.1.13438 WP_003898693.1.13489 WP_003898693.1.13551 WP_003898693.1.13579 WP_003898693.1.13687 WP_003898693.1.13719 WP_003898693.1.13763 WP_003898693.1.1377 WP_003898693.1.13786 WP_003898693.1.13817 WP_003898693.1.13880 WP_003898693.1.13899 WP_003898693.1.13909 WP_003898693.1.13952 WP_003898693.1.13962 WP_003898693.1.1398 WP_003898693.1.14027 WP_003898693.1.14115 WP_003898693.1.1415 WP_003898693.1.14152 WP_003898693.1.14162 WP_003898693.1.14175 WP_003898693.1.14194 WP_003898693.1.14195 WP_003898693.1.14238 WP_003898693.1.14382 WP_003898693.1.14441 WP_003898693.1.14469 WP_003898693.1.14527 WP_003898693.1.14544 WP_003898693.1.14551 WP_003898693.1.14573 WP_003898693.1.14668 WP_003898693.1.14675 WP_003898693.1.14695 WP_003898693.1.14766 WP_003898693.1.14783 WP_003898693.1.14865 WP_003898693.1.14872 WP_003898693.1.14905 WP_003898693.1.14955 WP_003898693.1.15003 WP_003898693.1.15009 WP_003898693.1.15040 WP_003898693.1.15126 WP_003898693.1.15174 WP_003898693.1.15187 WP_003898693.1.15196 WP_003898693.1.1523 WP_003898693.1.15240 WP_003898693.1.1527 WP_003898693.1.15292 WP_003898693.1.15302 WP_003898693.1.15322 WP_003898693.1.15386 WP_003898693.1.15442 WP_003898693.1.15447 WP_003898693.1.15477 WP_003898693.1.15511 WP_003898693.1.15558 WP_003898693.1.15559 WP_003898693.1.15566 WP_003898693.1.15599 WP_003898693.1.1560 WP_003898693.1.15633 WP_003898693.1.15755 WP_003898693.1.1578 WP_003898693.1.15780 WP_003898693.1.15848 WP_003898693.1.15870 WP_003898693.1.15877 WP_003898693.1.15896 WP_003898693.1.15926 WP_003898693.1.15933 WP_003898693.1.15958 WP_003898693.1.15973 WP_003898693.1.16009 WP_003898693.1.16077 WP_003898693.1.16108 WP_003898693.1.16130 WP_003898693.1.16136 WP_003898693.1.16141 WP_003898693.1.1632 WP_003898693.1.16327 WP_003898693.1.16334 WP_003898693.1.16374 WP_003898693.1.16384 WP_003898693.1.16386 WP_003898693.1.1642 WP_003898693.1.16424 WP_003898693.1.16431 WP_003898693.1.1644 WP_003898693.1.16442 WP_003898693.1.16448 WP_003898693.1.16451 WP_003898693.1.16494 WP_003898693.1.1652 WP_003898693.1.16609 WP_003898693.1.16620 WP_003898693.1.16622 WP_003898693.1.16724 WP_003898693.1.16731 WP_003898693.1.1683 WP_003898693.1.16937 WP_003898693.1.16940 WP_003898693.1.16968 WP_003898693.1.17006 WP_003898693.1.17041 WP_003898693.1.17057 WP_003898693.1.17062 WP_003898693.1.17130 WP_003898693.1.17138 WP_003898693.1.17224 WP_003898693.1.17345 WP_003898693.1.17381 WP_003898693.1.17391 WP_003898693.1.1743 WP_003898693.1.17440 WP_003898693.1.17466 WP_003898693.1.17477 WP_003898693.1.17553 WP_003898693.1.17635 WP_003898693.1.17713 WP_003898693.1.17722 WP_003898693.1.17746 WP_003898693.1.17803 WP_003898693.1.17816 WP_003898693.1.17821 WP_003898693.1.17923 WP_003898693.1.1795 WP_003898693.1.17955 WP_003898693.1.18033 WP_003898693.1.18057 WP_003898693.1.18065 WP_003898693.1.18126 WP_003898693.1.1817 WP_003898693.1.18240 WP_003898693.1.18257 WP_003898693.1.18297 WP_003898693.1.18306 WP_003898693.1.18399 WP_003898693.1.18448 WP_003898693.1.18467 WP_003898693.1.18582 WP_003898693.1.18694 WP_003898693.1.18710 WP_003898693.1.18793 WP_003898693.1.18838 WP_003898693.1.19005 WP_003898693.1.19066 WP_003898693.1.19085 WP_003898693.1.19094 WP_003898693.1.19144 WP_003898693.1.19159 WP_003898693.1.19231 WP_003898693.1.19264 WP_003898693.1.19295 WP_003898693.1.19307 WP_003898693.1.19326 WP_003898693.1.1933 WP_003898693.1.19364 WP_003898693.1.19429 WP_003898693.1.19464 WP_003898693.1.19564 WP_003898693.1.19568 WP_003898693.1.19572 WP_003898693.1.19595 WP_003898693.1.19600 WP_003898693.1.19630 WP_003898693.1.19694 WP_003898693.1.19742 WP_003898693.1.19820 WP_003898693.1.19868 WP_003898693.1.19874 WP_003898693.1.19890 WP_003898693.1.19900 WP_003898693.1.19949 WP_003898693.1.2003 WP_003898693.1.20037 WP_003898693.1.20039 WP_003898693.1.20082 WP_003898693.1.20116 WP_003898693.1.20140 WP_003898693.1.20141 WP_003898693.1.20158 WP_003898693.1.20239 WP_003898693.1.20243 WP_003898693.1.20259 WP_003898693.1.20262 WP_003898693.1.20272 WP_003898693.1.20280 WP_003898693.1.20294 WP_003898693.1.20300 WP_003898693.1.20322 WP_003898693.1.2037 WP_003898693.1.20372 WP_003898693.1.20381 WP_003898693.1.204 WP_003898693.1.20460 WP_003898693.1.20624 WP_003898693.1.20628 WP_003898693.1.2066 WP_003898693.1.2086 WP_003898693.1.20898 WP_003898693.1.2090 WP_003898693.1.20911 WP_003898693.1.20921 WP_003898693.1.20926 WP_003898693.1.2104 WP_003898693.1.21070 WP_003898693.1.21187 WP_003898693.1.2120 WP_003898693.1.2123 WP_003898693.1.21311 WP_003898693.1.21321 WP_003898693.1.21392 WP_003898693.1.21397 WP_003898693.1.21430 WP_003898693.1.21434 WP_003898693.1.21444 WP_003898693.1.21509 WP_003898693.1.21560 WP_003898693.1.21591 WP_003898693.1.21594 WP_003898693.1.21615 WP_003898693.1.21655 WP_003898693.1.21658 WP_003898693.1.2168 WP_003898693.1.2174 WP_003898693.1.21741 WP_003898693.1.21786 WP_003898693.1.21795 WP_003898693.1.21840 WP_003898693.1.21906 WP_003898693.1.21912 WP_003898693.1.21960 WP_003898693.1.21971 WP_003898693.1.22025 WP_003898693.1.22036 WP_003898693.1.22092 WP_003898693.1.22127 WP_003898693.1.22140 WP_003898693.1.2238 WP_003898693.1.22437 WP_003898693.1.22524 WP_003898693.1.22585 WP_003898693.1.22606 WP_003898693.1.22608 WP_003898693.1.22618 WP_003898693.1.22629 WP_003898693.1.22664 WP_003898693.1.22733 WP_003898693.1.22737 WP_003898693.1.22829 WP_003898693.1.22997 WP_003898693.1.22999 WP_003898693.1.23015 WP_003898693.1.231 WP_003898693.1.23101 WP_003898693.1.23171 WP_003898693.1.23199 WP_003898693.1.2320 WP_003898693.1.23216 WP_003898693.1.23272 WP_003898693.1.23289 WP_003898693.1.2329 WP_003898693.1.23308 WP_003898693.1.23316 WP_003898693.1.23321 WP_003898693.1.23445 WP_003898693.1.23447 WP_003898693.1.23461 WP_003898693.1.23573 WP_003898693.1.23692 WP_003898693.1.2384 WP_003898693.1.23863 WP_003898693.1.23894 WP_003898693.1.23993 WP_003898693.1.24007 WP_003898693.1.24008 WP_003898693.1.24046 WP_003898693.1.24057 WP_003898693.1.24113 WP_003898693.1.24119 WP_003898693.1.24140 WP_003898693.1.24202 WP_003898693.1.24284 WP_003898693.1.24423 WP_003898693.1.2443 WP_003898693.1.24500 WP_003898693.1.24507 WP_003898693.1.24509 WP_003898693.1.24599 WP_003898693.1.24638 WP_003898693.1.2466 WP_003898693.1.24824 WP_003898693.1.24840 WP_003898693.1.24848 WP_003898693.1.24857 WP_003898693.1.2487 WP_003898693.1.24893 WP_003898693.1.24958 WP_003898693.1.24985 WP_003898693.1.2499 WP_003898693.1.2507 WP_003898693.1.25103 WP_003898693.1.25129 WP_003898693.1.25171 WP_003898693.1.25247 WP_003898693.1.25278 WP_003898693.1.25342 WP_003898693.1.25343 WP_003898693.1.25406 WP_003898693.1.25435 WP_003898693.1.25437 WP_003898693.1.25445 WP_003898693.1.25473 WP_003898693.1.25504 WP_003898693.1.25513 WP_003898693.1.25594 WP_003898693.1.25674 WP_003898693.1.25699 WP_003898693.1.25756 WP_003898693.1.25874 WP_003898693.1.25885 WP_003898693.1.25892 WP_003898693.1.25916 WP_003898693.1.26032 WP_003898693.1.26089 WP_003898693.1.26098 WP_003898693.1.26126 WP_003898693.1.26168 WP_003898693.1.26182 WP_003898693.1.2620 WP_003898693.1.26243 WP_003898693.1.26267 WP_003898693.1.26349 WP_003898693.1.26366 WP_003898693.1.26374 WP_003898693.1.26407 WP_003898693.1.2653 WP_003898693.1.26603 WP_003898693.1.26629 WP_003898693.1.26651 WP_003898693.1.26719 WP_003898693.1.26738 WP_003898693.1.26745 WP_003898693.1.26756 WP_003898693.1.2676 WP_003898693.1.2677 WP_003898693.1.26780 WP_003898693.1.26854 WP_003898693.1.26868 WP_003898693.1.26888 WP_003898693.1.26959 WP_003898693.1.26969 WP_003898693.1.27017 WP_003898693.1.27045 WP_003898693.1.27075 WP_003898693.1.27128 WP_003898693.1.27130 WP_003898693.1.27139 WP_003898693.1.27164 WP_003898693.1.27369 WP_003898693.1.27402 WP_003898693.1.27410 WP_003898693.1.27411 WP_003898693.1.27449 WP_003898693.1.27463 WP_003898693.1.2749 WP_003898693.1.27492 WP_003898693.1.27528 WP_003898693.1.27541 WP_003898693.1.27596 WP_003898693.1.27724 WP_003898693.1.27730 WP_003898693.1.27736 WP_003898693.1.27771 WP_003898693.1.27819 WP_003898693.1.27915 WP_003898693.1.27935 WP_003898693.1.28106 WP_003898693.1.28142 WP_003898693.1.28192 WP_003898693.1.28202 WP_003898693.1.28241 WP_003898693.1.28242 WP_003898693.1.28251 WP_003898693.1.28255 WP_003898693.1.28269 WP_003898693.1.28276 WP_003898693.1.28293 WP_003898693.1.28391 WP_003898693.1.28448 WP_003898693.1.28610 WP_003898693.1.28634 WP_003898693.1.28642 WP_003898693.1.28671 WP_003898693.1.28703 WP_003898693.1.28739 WP_003898693.1.28781 WP_003898693.1.28850 WP_003898693.1.28914 WP_003898693.1.28935 WP_003898693.1.28952 WP_003898693.1.29234 WP_003898693.1.29264 WP_003898693.1.29275 WP_003898693.1.29339 WP_003898693.1.29348 WP_003898693.1.29449 WP_003898693.1.29452 WP_003898693.1.29510 WP_003898693.1.29515 WP_003898693.1.2953 WP_003898693.1.2959 WP_003898693.1.29592 WP_003898693.1.29599 WP_003898693.1.29611 WP_003898693.1.29632 WP_003898693.1.29649 WP_003898693.1.29659 WP_003898693.1.29698 WP_003898693.1.29718 WP_003898693.1.29745 WP_003898693.1.29769 WP_003898693.1.29825 WP_003898693.1.29847 WP_003898693.1.29883 WP_003898693.1.299 WP_003898693.1.29960 WP_003898693.1.3004 WP_003898693.1.30040 WP_003898693.1.30074 WP_003898693.1.30097 WP_003898693.1.30106 WP_003898693.1.30126 WP_003898693.1.30131 WP_003898693.1.30138 WP_003898693.1.30145 WP_003898693.1.3027 WP_003898693.1.30282 WP_003898693.1.30283 WP_003898693.1.30288 WP_003898693.1.30291 WP_003898693.1.30374 WP_003898693.1.30404 WP_003898693.1.30433 WP_003898693.1.30462 WP_003898693.1.30468 WP_003898693.1.30500 WP_003898693.1.30641 WP_003898693.1.30661 WP_003898693.1.30683 WP_003898693.1.30699 WP_003898693.1.30730 WP_003898693.1.30760 WP_003898693.1.30791 WP_003898693.1.308 WP_003898693.1.30824 WP_003898693.1.30888 WP_003898693.1.30901 WP_003898693.1.30912 WP_003898693.1.30913 WP_003898693.1.30914 WP_003898693.1.3100 WP_003898693.1.31034 WP_003898693.1.31047 WP_003898693.1.31070 WP_003898693.1.31102 WP_003898693.1.31184 WP_003898693.1.31226 WP_003898693.1.31233 WP_003898693.1.31270 WP_003898693.1.31304 WP_003898693.1.31346 WP_003898693.1.31348 WP_003898693.1.31428 WP_003898693.1.31458 WP_003898693.1.31498 WP_003898693.1.31507 WP_003898693.1.31569 WP_003898693.1.316 WP_003898693.1.31629 WP_003898693.1.31744 WP_003898693.1.31776 WP_003898693.1.31783 WP_003898693.1.318 WP_003898693.1.31880 WP_003898693.1.31911 WP_003898693.1.31955 WP_003898693.1.31991 WP_003898693.1.32004 WP_003898693.1.32039 WP_003898693.1.32132 WP_003898693.1.32157 WP_003898693.1.32164 WP_003898693.1.32179 WP_003898693.1.32317 WP_003898693.1.32383 WP_003898693.1.32416 WP_003898693.1.32461 WP_003898693.1.32482 WP_003898693.1.32503 WP_003898693.1.32562 WP_003898693.1.32592 WP_003898693.1.32653 WP_003898693.1.32695 WP_003898693.1.32716 WP_003898693.1.32752 WP_003898693.1.32780 WP_003898693.1.32781 WP_003898693.1.32793 WP_003898693.1.32799 WP_003898693.1.32833 WP_003898693.1.32862 WP_003898693.1.32909 WP_003898693.1.33007 WP_003898693.1.3302 WP_003898693.1.33028 WP_003898693.1.33044 WP_003898693.1.3321 WP_003898693.1.33215 WP_003898693.1.33288 WP_003898693.1.33305 WP_003898693.1.3331 WP_003898693.1.33393 WP_003898693.1.3349 WP_003898693.1.33542 WP_003898693.1.33601 WP_003898693.1.33646 WP_003898693.1.33673 WP_003898693.1.3369 WP_003898693.1.33705 WP_003898693.1.33783 WP_003898693.1.3383 WP_003898693.1.33832 WP_003898693.1.33839 WP_003898693.1.33848 WP_003898693.1.3387 WP_003898693.1.33886 WP_003898693.1.33912 WP_003898693.1.33954 WP_003898693.1.34042 WP_003898693.1.34055 WP_003898693.1.34065 WP_003898693.1.34090 WP_003898693.1.34197 WP_003898693.1.34198 WP_003898693.1.34215 WP_003898693.1.34219 WP_003898693.1.34255 WP_003898693.1.34260 WP_003898693.1.34275 WP_003898693.1.343 WP_003898693.1.344 WP_003898693.1.3443 WP_003898693.1.34435 WP_003898693.1.34446 WP_003898693.1.34505 WP_003898693.1.34516 WP_003898693.1.34551 WP_003898693.1.34576 WP_003898693.1.34596 WP_003898693.1.34599 WP_003898693.1.34639 WP_003898693.1.34673 WP_003898693.1.34755 WP_003898693.1.34783 WP_003898693.1.34908 WP_003898693.1.3492 WP_003898693.1.34933 WP_003898693.1.34954 WP_003898693.1.34963 WP_003898693.1.35023 WP_003898693.1.35069 WP_003898693.1.35072 WP_003898693.1.35078 WP_003898693.1.35156 WP_003898693.1.35160 WP_003898693.1.35162 WP_003898693.1.3520 WP_003898693.1.35213 WP_003898693.1.35246 WP_003898693.1.35278 WP_003898693.1.35312 WP_003898693.1.35319 WP_003898693.1.35396 WP_003898693.1.35439 WP_003898693.1.35492 WP_003898693.1.35555 WP_003898693.1.35561 WP_003898693.1.35610 WP_003898693.1.35689 WP_003898693.1.35770 WP_003898693.1.35780 WP_003898693.1.35821 WP_003898693.1.3584 WP_003898693.1.35874 WP_003898693.1.36005 WP_003898693.1.36023 WP_003898693.1.36053 WP_003898693.1.36089 WP_003898693.1.36116 WP_003898693.1.36145 WP_003898693.1.36228 WP_003898693.1.36252 WP_003898693.1.36260 WP_003898693.1.36271 WP_003898693.1.36303 WP_003898693.1.36321 WP_003898693.1.36326 WP_003898693.1.3634 WP_003898693.1.36357 WP_003898693.1.3636 WP_003898693.1.36465 WP_003898693.1.36473 WP_003898693.1.36485 WP_003898693.1.36561 WP_003898693.1.36573 WP_003898693.1.36585 WP_003898693.1.36597 WP_003898693.1.36674 WP_003898693.1.36720 WP_003898693.1.36727 WP_003898693.1.36862 WP_003898693.1.36921 WP_003898693.1.36941 WP_003898693.1.37004 WP_003898693.1.37012 WP_003898693.1.37071 WP_003898693.1.37088 WP_003898693.1.37131 WP_003898693.1.37188 WP_003898693.1.37213 WP_003898693.1.3724 WP_003898693.1.37277 WP_003898693.1.37330 WP_003898693.1.37468 WP_003898693.1.37612 WP_003898693.1.37632 WP_003898693.1.37643 WP_003898693.1.37674 WP_003898693.1.37701 WP_003898693.1.37709 WP_003898693.1.37711 WP_003898693.1.37765 WP_003898693.1.37772 WP_003898693.1.37912 WP_003898693.1.37943 WP_003898693.1.37950 WP_003898693.1.37983 WP_003898693.1.38039 WP_003898693.1.38040 WP_003898693.1.38067 WP_003898693.1.38144 WP_003898693.1.38159 WP_003898693.1.38299 WP_003898693.1.38347 WP_003898693.1.38389 WP_003898693.1.38402 WP_003898693.1.38418 WP_003898693.1.38477 WP_003898693.1.3849 WP_003898693.1.38611 WP_003898693.1.38638 WP_003898693.1.38646 WP_003898693.1.38648 WP_003898693.1.38654 WP_003898693.1.38666 WP_003898693.1.38671 WP_003898693.1.38750 WP_003898693.1.38812 WP_003898693.1.38844 WP_003898693.1.38863 WP_003898693.1.38894 WP_003898693.1.38909 WP_003898693.1.38939 WP_003898693.1.38975 WP_003898693.1.39025 WP_003898693.1.39072 WP_003898693.1.39095 WP_003898693.1.39106 WP_003898693.1.39165 WP_003898693.1.39176 WP_003898693.1.39207 WP_003898693.1.39239 WP_003898693.1.39288 WP_003898693.1.39359 WP_003898693.1.39364 WP_003898693.1.39400 WP_003898693.1.39450 WP_003898693.1.39455 WP_003898693.1.39560 WP_003898693.1.39592 WP_003898693.1.39593 WP_003898693.1.396 WP_003898693.1.39657 WP_003898693.1.39661 WP_003898693.1.39674 WP_003898693.1.39678 WP_003898693.1.3968 WP_003898693.1.39694 WP_003898693.1.3971 WP_003898693.1.39718 WP_003898693.1.39739 WP_003898693.1.39748 WP_003898693.1.39801 WP_003898693.1.39877 WP_003898693.1.3996 WP_003898693.1.39980 WP_003898693.1.40028 WP_003898693.1.4003 WP_003898693.1.40156 WP_003898693.1.40353 WP_003898693.1.40372 WP_003898693.1.40440 WP_003898693.1.40446 WP_003898693.1.40641 WP_003898693.1.4067 WP_003898693.1.40731 WP_003898693.1.40799 WP_003898693.1.40881 WP_003898693.1.40922 WP_003898693.1.4095 WP_003898693.1.40956 WP_003898693.1.40964 WP_003898693.1.4097 WP_003898693.1.410 WP_003898693.1.41055 WP_003898693.1.41123 WP_003898693.1.41219 WP_003898693.1.4127 WP_003898693.1.41376 WP_003898693.1.41430 WP_003898693.1.41636 WP_003898693.1.41648 WP_003898693.1.41660 WP_003898693.1.4171 WP_003898693.1.41719 WP_003898693.1.41733 WP_003898693.1.41774 WP_003898693.1.41828 WP_003898693.1.41933 WP_003898693.1.41944 WP_003898693.1.42078 WP_003898693.1.42094 WP_003898693.1.42112 WP_003898693.1.4212 WP_003898693.1.42183 WP_003898693.1.42188 WP_003898693.1.42202 WP_003898693.1.42208 WP_003898693.1.42247 WP_003898693.1.42273 WP_003898693.1.42304 WP_003898693.1.42309 WP_003898693.1.42370 WP_003898693.1.42385 WP_003898693.1.42414 WP_003898693.1.42461 WP_003898693.1.42465 WP_003898693.1.42474 WP_003898693.1.42534 WP_003898693.1.4255 WP_003898693.1.42568 WP_003898693.1.42618 WP_003898693.1.42777 WP_003898693.1.42782 WP_003898693.1.42835 WP_003898693.1.42916 WP_003898693.1.42930 WP_003898693.1.42971 WP_003898693.1.43082 WP_003898693.1.43087 WP_003898693.1.43098 WP_003898693.1.43236 WP_003898693.1.43246 WP_003898693.1.43269 WP_003898693.1.4335 WP_003898693.1.43368 WP_003898693.1.43395 WP_003898693.1.43462 WP_003898693.1.43478 WP_003898693.1.43484 WP_003898693.1.43557 WP_003898693.1.43578 WP_003898693.1.43588 WP_003898693.1.43643 WP_003898693.1.43684 WP_003898693.1.43686 WP_003898693.1.43716 WP_003898693.1.43781 WP_003898693.1.43794 WP_003898693.1.43846 WP_003898693.1.43863 WP_003898693.1.43936 WP_003898693.1.43965 WP_003898693.1.4399 WP_003898693.1.43993 WP_003898693.1.44008 WP_003898693.1.44070 WP_003898693.1.44071 WP_003898693.1.44104 WP_003898693.1.44111 WP_003898693.1.44124 WP_003898693.1.44219 WP_003898693.1.44237 WP_003898693.1.44336 WP_003898693.1.44358 WP_003898693.1.4438 WP_003898693.1.44392 WP_003898693.1.44489 WP_003898693.1.44534 WP_003898693.1.44597 WP_003898693.1.44615 WP_003898693.1.44700 WP_003898693.1.44713 WP_003898693.1.44740 WP_003898693.1.44757 WP_003898693.1.44808 WP_003898693.1.44864 WP_003898693.1.44901 WP_003898693.1.44908 WP_003898693.1.45011 WP_003898693.1.4504 WP_003898693.1.45135 WP_003898693.1.45168 WP_003898693.1.4517 WP_003898693.1.45181 WP_003898693.1.45185 WP_003898693.1.45192 WP_003898693.1.45205 WP_003898693.1.45249 WP_003898693.1.45286 WP_003898693.1.45347 WP_003898693.1.454 WP_003898693.1.45460 WP_003898693.1.45470 WP_003898693.1.45491 WP_003898693.1.45584 WP_003898693.1.45590 WP_003898693.1.45666 WP_003898693.1.45743 WP_003898693.1.45765 WP_003898693.1.45776 WP_003898693.1.45815 WP_003898693.1.45867 WP_003898693.1.4590 WP_003898693.1.45923 WP_003898693.1.45926 WP_003898693.1.46025 WP_003898693.1.46090 WP_003898693.1.46127 WP_003898693.1.46128 WP_003898693.1.46150 WP_003898693.1.46201 WP_003898693.1.46253 WP_003898693.1.46268 WP_003898693.1.46285 WP_003898693.1.46300 WP_003898693.1.46365 WP_003898693.1.46370 WP_003898693.1.46381 WP_003898693.1.46453 WP_003898693.1.46478 WP_003898693.1.46521 WP_003898693.1.4653 WP_003898693.1.46532 WP_003898693.1.46539 WP_003898693.1.46585 WP_003898693.1.46773 WP_003898693.1.46786 WP_003898693.1.46851 WP_003898693.1.4687 WP_003898693.1.46936 WP_003898693.1.47106 WP_003898693.1.47142 WP_003898693.1.47147 WP_003898693.1.47166 WP_003898693.1.47207 WP_003898693.1.47402 WP_003898693.1.47502 WP_003898693.1.4751 WP_003898693.1.47511 WP_003898693.1.47568 WP_003898693.1.47588 WP_003898693.1.4764 WP_003898693.1.47653 WP_003898693.1.47681 WP_003898693.1.4771 WP_003898693.1.47717 WP_003898693.1.47743 WP_003898693.1.47773 WP_003898693.1.47776 WP_003898693.1.47847 WP_003898693.1.47858 WP_003898693.1.47861 WP_003898693.1.47868 WP_003898693.1.47893 WP_003898693.1.47913 WP_003898693.1.4794 WP_003898693.1.47943 WP_003898693.1.47944 WP_003898693.1.48004 WP_003898693.1.48039 WP_003898693.1.48050 WP_003898693.1.48084 WP_003898693.1.4813 WP_003898693.1.48135 WP_003898693.1.48152 WP_003898693.1.48173 WP_003898693.1.48177 WP_003898693.1.48219 WP_003898693.1.4823 WP_003898693.1.48330 WP_003898693.1.48348 WP_003898693.1.48354 WP_003898693.1.48388 WP_003898693.1.48419 WP_003898693.1.48423 WP_003898693.1.48543 WP_003898693.1.48550 WP_003898693.1.48605 WP_003898693.1.48648 WP_003898693.1.48798 WP_003898693.1.48802 WP_003898693.1.48826 WP_003898693.1.48843 WP_003898693.1.48979 WP_003898693.1.49017 WP_003898693.1.4906 WP_003898693.1.49103 WP_003898693.1.49254 WP_003898693.1.49263 WP_003898693.1.49296 WP_003898693.1.49419 WP_003898693.1.49426 WP_003898693.1.49439 WP_003898693.1.49474 WP_003898693.1.49523 WP_003898693.1.49532 WP_003898693.1.49709 WP_003898693.1.4971 WP_003898693.1.4972 WP_003898693.1.49746 WP_003898693.1.49764 WP_003898693.1.49773 WP_003898693.1.49839 WP_003898693.1.49878 WP_003898693.1.49880 WP_003898693.1.49944 WP_003898693.1.50081 WP_003898693.1.50149 WP_003898693.1.50194 WP_003898693.1.50218 WP_003898693.1.50235 WP_003898693.1.50271 WP_003898693.1.50324 WP_003898693.1.50372 WP_003898693.1.50398 WP_003898693.1.50407 WP_003898693.1.50444 WP_003898693.1.50472 WP_003898693.1.50498 WP_003898693.1.5050 WP_003898693.1.50633 WP_003898693.1.50659 WP_003898693.1.50689 WP_003898693.1.50729 WP_003898693.1.50794 WP_003898693.1.50841 WP_003898693.1.50877 WP_003898693.1.5096 WP_003898693.1.50981 WP_003898693.1.50987 WP_003898693.1.51082 WP_003898693.1.51101 WP_003898693.1.51116 WP_003898693.1.51149 WP_003898693.1.51156 WP_003898693.1.51157 WP_003898693.1.51213 WP_003898693.1.51232 WP_003898693.1.51247 WP_003898693.1.51279 WP_003898693.1.51291 WP_003898693.1.51301 WP_003898693.1.51329 WP_003898693.1.51468 WP_003898693.1.51478 WP_003898693.1.51593 WP_003898693.1.51628 WP_003898693.1.51647 WP_003898693.1.51721 WP_003898693.1.51801 WP_003898693.1.51817 WP_003898693.1.51819 WP_003898693.1.51854 WP_003898693.1.51948 WP_003898693.1.52000 WP_003898693.1.52001 WP_003898693.1.52036 WP_003898693.1.52059 WP_003898693.1.52069 WP_003898693.1.52166 WP_003898693.1.52168 WP_003898693.1.52173 WP_003898693.1.52216 WP_003898693.1.52238 WP_003898693.1.52241 WP_003898693.1.52280 WP_003898693.1.52314 WP_003898693.1.52385 WP_003898693.1.52486 WP_003898693.1.52531 WP_003898693.1.52563 WP_003898693.1.52564 WP_003898693.1.52673 WP_003898693.1.52713 WP_003898693.1.52778 WP_003898693.1.52818 WP_003898693.1.52873 WP_003898693.1.52998 WP_003898693.1.53088 WP_003898693.1.53117 WP_003898693.1.53118 WP_003898693.1.53167 WP_003898693.1.53200 WP_003898693.1.53226 WP_003898693.1.53230 WP_003898693.1.5327 WP_003898693.1.53276 WP_003898693.1.53306 WP_003898693.1.5335 WP_003898693.1.53413 WP_003898693.1.53458 WP_003898693.1.53460 WP_003898693.1.53522 WP_003898693.1.53525 WP_003898693.1.53553 WP_003898693.1.53643 WP_003898693.1.53667 WP_003898693.1.53679 WP_003898693.1.53715 WP_003898693.1.53742 WP_003898693.1.53743 WP_003898693.1.53787 WP_003898693.1.53818 WP_003898693.1.53865 WP_003898693.1.53914 WP_003898693.1.5398 WP_003898693.1.54093 WP_003898693.1.54099 WP_003898693.1.54112 WP_003898693.1.54141 WP_003898693.1.54218 WP_003898693.1.54225 WP_003898693.1.54247 WP_003898693.1.54280 WP_003898693.1.5429 WP_003898693.1.54294 WP_003898693.1.54314 WP_003898693.1.54370 WP_003898693.1.54449 WP_003898693.1.54514 WP_003898693.1.54519 WP_003898693.1.5452 WP_003898693.1.54555 WP_003898693.1.54575 WP_003898693.1.54686 WP_003898693.1.54687 WP_003898693.1.54797 WP_003898693.1.54807 WP_003898693.1.54897 WP_003898693.1.54939 WP_003898693.1.55015 WP_003898693.1.55022 WP_003898693.1.55051 WP_003898693.1.55072 WP_003898693.1.55088 WP_003898693.1.55106 WP_003898693.1.55150 WP_003898693.1.55258 WP_003898693.1.55279 WP_003898693.1.55326 WP_003898693.1.5533 WP_003898693.1.55345 WP_003898693.1.55396 WP_003898693.1.55441 WP_003898693.1.55459 WP_003898693.1.55641 WP_003898693.1.5569 WP_003898693.1.55772 WP_003898693.1.55802 WP_003898693.1.5591 WP_003898693.1.55977 WP_003898693.1.55983 WP_003898693.1.56057 WP_003898693.1.56060 WP_003898693.1.56132 WP_003898693.1.56327 WP_003898693.1.56359 WP_003898693.1.56394 WP_003898693.1.56443 WP_003898693.1.56473 WP_003898693.1.56517 WP_003898693.1.5656 WP_003898693.1.56593 WP_003898693.1.56637 WP_003898693.1.56670 WP_003898693.1.56697 WP_003898693.1.56769 WP_003898693.1.56770 WP_003898693.1.56795 WP_003898693.1.5681 WP_003898693.1.56827 WP_003898693.1.56839 WP_003898693.1.56868 WP_003898693.1.56915 WP_003898693.1.56971 WP_003898693.1.57035 WP_003898693.1.57077 WP_003898693.1.57094 WP_003898693.1.57230 WP_003898693.1.5725 WP_003898693.1.5727 WP_003898693.1.573 WP_003898693.1.57351 WP_003898693.1.57380 WP_003898693.1.57430 WP_003898693.1.5744 WP_003898693.1.5745 WP_003898693.1.57469 WP_003898693.1.57509 WP_003898693.1.57525 WP_003898693.1.57551 WP_003898693.1.57596 WP_003898693.1.57604 WP_003898693.1.57642 WP_003898693.1.57658 WP_003898693.1.57667 WP_003898693.1.57675 WP_003898693.1.57689 WP_003898693.1.57708 WP_003898693.1.57794 WP_003898693.1.57821 WP_003898693.1.57843 WP_003898693.1.57906 WP_003898693.1.57924 WP_003898693.1.57960 WP_003898693.1.57964 WP_003898693.1.58108 WP_003898693.1.58164 WP_003898693.1.582 WP_003898693.1.5824 WP_003898693.1.58259 WP_003898693.1.58283 WP_003898693.1.5830 WP_003898693.1.58303 WP_003898693.1.58311 WP_003898693.1.58359 WP_003898693.1.58488 WP_003898693.1.58534 WP_003898693.1.5865 WP_003898693.1.58702 WP_003898693.1.58743 WP_003898693.1.58754 WP_003898693.1.58857 WP_003898693.1.58891 WP_003898693.1.58892 WP_003898693.1.58953 WP_003898693.1.5898 WP_003898693.1.59025 WP_003898693.1.59029 WP_003898693.1.59037 WP_003898693.1.59044 WP_003898693.1.59085 WP_003898693.1.59088 WP_003898693.1.59130 WP_003898693.1.5914 WP_003898693.1.59209 WP_003898693.1.59240 WP_003898693.1.59253 WP_003898693.1.59254 WP_003898693.1.59262 WP_003898693.1.5928 WP_003898693.1.59304 WP_003898693.1.59326 WP_003898693.1.59328 WP_003898693.1.59338 WP_003898693.1.59428 WP_003898693.1.59537 WP_003898693.1.59677 WP_003898693.1.59738 WP_003898693.1.59757 WP_003898693.1.59808 WP_003898693.1.59850 WP_003898693.1.5987 WP_003898693.1.59878 WP_003898693.1.59888 WP_003898693.1.5996 WP_003898693.1.59961 WP_003898693.1.6003 WP_003898693.1.60047 WP_003898693.1.60121 WP_003898693.1.60135 WP_003898693.1.60205 WP_003898693.1.60215 WP_003898693.1.60267 WP_003898693.1.60288 WP_003898693.1.60291 WP_003898693.1.60301 WP_003898693.1.60305 WP_003898693.1.60421 WP_003898693.1.60451 WP_003898693.1.60460 WP_003898693.1.60487 WP_003898693.1.60583 WP_003898693.1.60687 WP_003898693.1.60689 WP_003898693.1.60727 WP_003898693.1.60738 WP_003898693.1.60763 WP_003898693.1.60791 WP_003898693.1.60879 WP_003898693.1.60913 WP_003898693.1.61012 WP_003898693.1.61101 WP_003898693.1.61198 WP_003898693.1.61234 WP_003898693.1.61281 WP_003898693.1.61368 WP_003898693.1.61409 WP_003898693.1.61420 WP_003898693.1.61422 WP_003898693.1.61428 WP_003898693.1.61469 WP_003898693.1.61522 WP_003898693.1.61567 WP_003898693.1.61573 WP_003898693.1.61584 WP_003898693.1.61586 WP_003898693.1.6159 WP_003898693.1.61592 WP_003898693.1.6160 WP_003898693.1.61614 WP_003898693.1.61692 WP_003898693.1.61750 WP_003898693.1.61755 WP_003898693.1.61757 WP_003898693.1.61816 WP_003898693.1.61850 WP_003898693.1.61868 WP_003898693.1.61911 WP_003898693.1.61941 WP_003898693.1.61953 WP_003898693.1.61986 WP_003898693.1.62021 WP_003898693.1.62087 WP_003898693.1.62089 WP_003898693.1.62104 WP_003898693.1.62225 WP_003898693.1.62249 WP_003898693.1.62270 WP_003898693.1.62307 WP_003898693.1.62371 WP_003898693.1.62379 WP_003898693.1.62395 WP_003898693.1.62508 WP_003898693.1.62565 WP_003898693.1.62616 WP_003898693.1.62715 WP_003898693.1.62738 WP_003898693.1.62761 WP_003898693.1.62813 WP_003898693.1.62839 WP_003898693.1.62909 WP_003898693.1.6295 WP_003898693.1.62962 WP_003898693.1.63007 WP_003898693.1.63032 WP_003898693.1.63064 WP_003898693.1.63066 WP_003898693.1.63072 WP_003898693.1.6308 WP_003898693.1.63081 WP_003898693.1.63096 WP_003898693.1.63106 WP_003898693.1.63222 WP_003898693.1.6328 WP_003898693.1.63373 WP_003898693.1.63384 WP_003898693.1.63403 WP_003898693.1.63424 WP_003898693.1.63428 WP_003898693.1.63464 WP_003898693.1.63502 WP_003898693.1.63504 WP_003898693.1.63564 WP_003898693.1.63567 WP_003898693.1.63596 WP_003898693.1.63627 WP_003898693.1.63654 WP_003898693.1.63819 WP_003898693.1.63844 WP_003898693.1.63915 WP_003898693.1.63918 WP_003898693.1.63961 WP_003898693.1.64000 WP_003898693.1.64027 WP_003898693.1.64082 WP_003898693.1.64091 WP_003898693.1.64102 WP_003898693.1.6422 WP_003898693.1.64222 WP_003898693.1.64228 WP_003898693.1.64235 WP_003898693.1.6427 WP_003898693.1.64414 WP_003898693.1.64419 WP_003898693.1.6443 WP_003898693.1.64463 WP_003898693.1.64506 WP_003898693.1.64513 WP_003898693.1.64522 WP_003898693.1.64526 WP_003898693.1.64543 WP_003898693.1.6456 WP_003898693.1.64567 WP_003898693.1.64595 WP_003898693.1.6464 WP_003898693.1.64669 WP_003898693.1.64672 WP_003898693.1.64680 WP_003898693.1.64682 WP_003898693.1.64727 WP_003898693.1.64729 WP_003898693.1.64774 WP_003898693.1.6486 WP_003898693.1.64870 WP_003898693.1.6493 WP_003898693.1.64941 WP_003898693.1.64973 WP_003898693.1.65053 WP_003898693.1.65181 WP_003898693.1.65212 WP_003898693.1.65229 WP_003898693.1.65253 WP_003898693.1.65329 WP_003898693.1.6536 WP_003898693.1.65374 WP_003898693.1.65433 WP_003898693.1.65467 WP_003898693.1.65583 WP_003898693.1.65623 WP_003898693.1.65635 WP_003898693.1.65648 WP_003898693.1.65683 WP_003898693.1.65686 WP_003898693.1.65707 WP_003898693.1.65747 WP_003898693.1.65816 WP_003898693.1.65862 WP_003898693.1.65929 WP_003898693.1.65974 WP_003898693.1.66089 WP_003898693.1.66149 WP_003898693.1.66276 WP_003898693.1.66293 WP_003898693.1.66297 WP_003898693.1.66323 WP_003898693.1.66325 WP_003898693.1.66355 WP_003898693.1.66455 WP_003898693.1.66466 WP_003898693.1.66487 WP_003898693.1.66558 WP_003898693.1.66612 WP_003898693.1.66663 WP_003898693.1.66715 WP_003898693.1.66718 WP_003898693.1.66826 WP_003898693.1.66868 WP_003898693.1.66878 WP_003898693.1.66961 WP_003898693.1.6704 WP_003898693.1.67061 WP_003898693.1.67146 WP_003898693.1.67220 WP_003898693.1.67231 WP_003898693.1.6724 WP_003898693.1.67257 WP_003898693.1.67298 WP_003898693.1.67307 WP_003898693.1.67332 WP_003898693.1.67346 WP_003898693.1.67360 WP_003898693.1.67381 WP_003898693.1.67396 WP_003898693.1.67417 WP_003898693.1.67422 WP_003898693.1.67459 WP_003898693.1.6746 WP_003898693.1.67473 WP_003898693.1.67523 WP_003898693.1.67575 WP_003898693.1.67598 WP_003898693.1.67600 WP_003898693.1.67744 WP_003898693.1.6775 WP_003898693.1.6777 WP_003898693.1.67848 WP_003898693.1.67870 WP_003898693.1.67888 WP_003898693.1.67915 WP_003898693.1.67982 WP_003898693.1.68057 WP_003898693.1.68083 WP_003898693.1.68169 WP_003898693.1.68193 WP_003898693.1.68227 WP_003898693.1.68384 WP_003898693.1.68429 WP_003898693.1.6843 WP_003898693.1.68433 WP_003898693.1.68465 WP_003898693.1.68518 WP_003898693.1.68569 WP_003898693.1.68576 WP_003898693.1.68580 WP_003898693.1.68623 WP_003898693.1.68637 WP_003898693.1.68646 WP_003898693.1.68667 WP_003898693.1.68669 WP_003898693.1.68672 WP_003898693.1.68708 WP_003898693.1.68730 WP_003898693.1.68748 WP_003898693.1.68754 WP_003898693.1.6876 WP_003898693.1.68766 WP_003898693.1.68824 WP_003898693.1.68832 WP_003898693.1.68833 WP_003898693.1.68841 WP_003898693.1.68916 WP_003898693.1.68945 WP_003898693.1.68981 WP_003898693.1.69079 WP_003898693.1.69082 WP_003898693.1.69231 WP_003898693.1.69256 WP_003898693.1.69311 WP_003898693.1.69315 WP_003898693.1.69322 WP_003898693.1.69342 WP_003898693.1.6936 WP_003898693.1.69427 WP_003898693.1.6951 WP_003898693.1.69511 WP_003898693.1.69526 WP_003898693.1.69547 WP_003898693.1.69573 WP_003898693.1.6960 WP_003898693.1.69617 WP_003898693.1.69647 WP_003898693.1.69673 WP_003898693.1.69684 WP_003898693.1.69686 WP_003898693.1.69707 WP_003898693.1.69709 WP_003898693.1.69723 WP_003898693.1.69800 WP_003898693.1.69802 WP_003898693.1.69870 WP_003898693.1.69873 WP_003898693.1.69898 WP_003898693.1.69931 WP_003898693.1.69955 WP_003898693.1.69957 WP_003898693.1.69981 WP_003898693.1.70032 WP_003898693.1.70131 WP_003898693.1.7022 WP_003898693.1.7029 WP_003898693.1.70328 WP_003898693.1.70356 WP_003898693.1.70369 WP_003898693.1.70418 WP_003898693.1.70435 WP_003898693.1.70463 WP_003898693.1.70480 WP_003898693.1.70494 WP_003898693.1.70498 WP_003898693.1.70525 WP_003898693.1.70573 WP_003898693.1.70615 WP_003898693.1.70622 WP_003898693.1.70704 WP_003898693.1.70796 WP_003898693.1.70830 WP_003898693.1.70915 WP_003898693.1.70964 WP_003898693.1.70976 WP_003898693.1.71063 WP_003898693.1.7111 WP_003898693.1.71118 WP_003898693.1.71259 WP_003898693.1.71289 WP_003898693.1.71326 WP_003898693.1.71329 WP_003898693.1.71344 WP_003898693.1.71390 WP_003898693.1.71440 WP_003898693.1.71490 WP_003898693.1.71492 WP_003898693.1.71509 WP_003898693.1.71516 WP_003898693.1.71517 WP_003898693.1.71532 WP_003898693.1.71545 WP_003898693.1.71546 WP_003898693.1.71569 WP_003898693.1.71604 WP_003898693.1.71630 WP_003898693.1.71638 WP_003898693.1.71664 WP_003898693.1.71683 WP_003898693.1.71718 WP_003898693.1.71781 WP_003898693.1.71847 WP_003898693.1.71871 WP_003898693.1.71909 WP_003898693.1.71957 WP_003898693.1.71970 WP_003898693.1.72047 WP_003898693.1.72061 WP_003898693.1.72111 WP_003898693.1.72122 WP_003898693.1.72143 WP_003898693.1.72332 WP_003898693.1.72405 WP_003898693.1.72420 WP_003898693.1.72451 WP_003898693.1.72457 WP_003898693.1.72459 WP_003898693.1.72466 WP_003898693.1.72487 WP_003898693.1.72506 WP_003898693.1.72543 WP_003898693.1.72640 WP_003898693.1.72739 WP_003898693.1.72744 WP_003898693.1.72784 WP_003898693.1.72826 WP_003898693.1.72831 WP_003898693.1.72852 WP_003898693.1.72879 WP_003898693.1.72880 WP_003898693.1.72957 WP_003898693.1.72959 WP_003898693.1.72982 WP_003898693.1.72988 WP_003898693.1.72993 WP_003898693.1.73042 WP_003898693.1.73092 WP_003898693.1.73118 WP_003898693.1.73127 WP_003898693.1.73163 WP_003898693.1.73205 WP_003898693.1.73391 WP_003898693.1.73424 WP_003898693.1.73445 WP_003898693.1.73465 WP_003898693.1.73466 WP_003898693.1.73478 WP_003898693.1.73482 WP_003898693.1.73507 WP_003898693.1.73532 WP_003898693.1.73550 WP_003898693.1.73564 WP_003898693.1.73623 WP_003898693.1.73644 WP_003898693.1.73688 WP_003898693.1.73744 WP_003898693.1.73760 WP_003898693.1.73774 WP_003898693.1.7379 WP_003898693.1.73813 WP_003898693.1.73840 WP_003898693.1.73876 WP_003898693.1.7389 WP_003898693.1.74039 WP_003898693.1.74083 WP_003898693.1.74107 WP_003898693.1.74144 WP_003898693.1.7417 WP_003898693.1.7423 WP_003898693.1.74259 WP_003898693.1.74262 WP_003898693.1.74296 WP_003898693.1.7436 WP_003898693.1.74378 WP_003898693.1.74395 WP_003898693.1.74432 WP_003898693.1.74555 WP_003898693.1.74628 WP_003898693.1.74641 WP_003898693.1.74653 WP_003898693.1.74660 WP_003898693.1.74888 WP_003898693.1.74952 WP_003898693.1.75043 WP_003898693.1.75055 WP_003898693.1.75078 WP_003898693.1.75081 WP_003898693.1.75163 WP_003898693.1.75188 WP_003898693.1.75200 WP_003898693.1.75239 WP_003898693.1.7535 WP_003898693.1.75376 WP_003898693.1.75391 WP_003898693.1.75441 WP_003898693.1.75581 WP_003898693.1.75635 WP_003898693.1.75665 WP_003898693.1.75741 WP_003898693.1.75772 WP_003898693.1.75774 WP_003898693.1.75833 WP_003898693.1.7585 WP_003898693.1.75864 WP_003898693.1.75974 WP_003898693.1.76016 WP_003898693.1.76032 WP_003898693.1.76037 WP_003898693.1.7604 WP_003898693.1.76064 WP_003898693.1.76110 WP_003898693.1.76172 WP_003898693.1.76177 WP_003898693.1.76183 WP_003898693.1.76272 WP_003898693.1.76291 WP_003898693.1.76379 WP_003898693.1.76403 WP_003898693.1.76414 WP_003898693.1.76427 WP_003898693.1.76442 WP_003898693.1.76443 WP_003898693.1.76456 WP_003898693.1.76625 WP_003898693.1.76629 WP_003898693.1.76678 WP_003898693.1.76781 WP_003898693.1.76818 WP_003898693.1.76824 WP_003898693.1.76835 WP_003898693.1.76873 WP_003898693.1.76900 WP_003898693.1.7691 WP_003898693.1.76947 WP_003898693.1.76954 WP_003898693.1.76955 WP_003898693.1.77000 WP_003898693.1.77021 WP_003898693.1.77065 WP_003898693.1.77075 WP_003898693.1.77107 WP_003898693.1.77260 WP_003898693.1.77266 WP_003898693.1.77285 WP_003898693.1.77312 WP_003898693.1.77348 WP_003898693.1.77352 WP_003898693.1.77361 WP_003898693.1.774 WP_003898693.1.77425 WP_003898693.1.7748 WP_003898693.1.77484 WP_003898693.1.77599 WP_003898693.1.77627 WP_003898693.1.77654 WP_003898693.1.77667 WP_003898693.1.77704 WP_003898693.1.77774 WP_003898693.1.77790 WP_003898693.1.77809 WP_003898693.1.77843 WP_003898693.1.77865 WP_003898693.1.77909 WP_003898693.1.78020 WP_003898693.1.78024 WP_003898693.1.78086 WP_003898693.1.7809 WP_003898693.1.78136 WP_003898693.1.78162 WP_003898693.1.7817 WP_003898693.1.78236 WP_003898693.1.78238 WP_003898693.1.78322 WP_003898693.1.78338 WP_003898693.1.78516 WP_003898693.1.78524 WP_003898693.1.78545 WP_003898693.1.78574 WP_003898693.1.78580 WP_003898693.1.7860 WP_003898693.1.78655 WP_003898693.1.78657 WP_003898693.1.78659 WP_003898693.1.78692 WP_003898693.1.78760 WP_003898693.1.78766 WP_003898693.1.78776 WP_003898693.1.78778 WP_003898693.1.78784 WP_003898693.1.78788 WP_003898693.1.78860 WP_003898693.1.78884 WP_003898693.1.79033 WP_003898693.1.79064 WP_003898693.1.79068 WP_003898693.1.79112 WP_003898693.1.79145 WP_003898693.1.79152 WP_003898693.1.79290 WP_003898693.1.79326 WP_003898693.1.79422 WP_003898693.1.79447 WP_003898693.1.79455 WP_003898693.1.79480 WP_003898693.1.79482 WP_003898693.1.79488 WP_003898693.1.79500 WP_003898693.1.79565 WP_003898693.1.79588 WP_003898693.1.79698 WP_003898693.1.797 WP_003898693.1.79744 WP_003898693.1.79806 WP_003898693.1.79819 WP_003898693.1.79851 WP_003898693.1.79853 WP_003898693.1.79881 WP_003898693.1.79913 WP_003898693.1.79947 WP_003898693.1.7995 WP_003898693.1.7997 WP_003898693.1.80084 WP_003898693.1.8026 WP_003898693.1.80275 WP_003898693.1.80299 WP_003898693.1.80370 WP_003898693.1.80387 WP_003898693.1.80451 WP_003898693.1.80458 WP_003898693.1.80461 WP_003898693.1.80490 WP_003898693.1.80503 WP_003898693.1.80552 WP_003898693.1.80588 WP_003898693.1.80599 WP_003898693.1.80624 WP_003898693.1.80636 WP_003898693.1.80673 WP_003898693.1.80711 WP_003898693.1.80714 WP_003898693.1.80815 WP_003898693.1.80918 WP_003898693.1.80967 WP_003898693.1.8097 WP_003898693.1.80988 WP_003898693.1.81013 WP_003898693.1.81059 WP_003898693.1.81066 WP_003898693.1.81075 WP_003898693.1.8114 WP_003898693.1.81189 WP_003898693.1.81192 WP_003898693.1.81230 WP_003898693.1.81249 WP_003898693.1.8128 WP_003898693.1.81287 WP_003898693.1.81439 WP_003898693.1.81465 WP_003898693.1.81538 WP_003898693.1.81541 WP_003898693.1.81561 WP_003898693.1.81686 WP_003898693.1.81731 WP_003898693.1.81788 WP_003898693.1.81820 WP_003898693.1.81850 WP_003898693.1.81891 WP_003898693.1.82011 WP_003898693.1.82048 WP_003898693.1.82209 WP_003898693.1.82210 WP_003898693.1.82251 WP_003898693.1.82346 WP_003898693.1.82385 WP_003898693.1.82483 WP_003898693.1.82531 WP_003898693.1.82549 WP_003898693.1.82598 WP_003898693.1.82681 WP_003898693.1.82774 WP_003898693.1.82803 WP_003898693.1.82860 WP_003898693.1.82935 WP_003898693.1.82957 WP_003898693.1.82981 WP_003898693.1.82983 WP_003898693.1.83004 WP_003898693.1.83146 WP_003898693.1.83149 WP_003898693.1.83173 WP_003898693.1.83181 WP_003898693.1.83212 WP_003898693.1.83262 WP_003898693.1.83273 WP_003898693.1.83332 WP_003898693.1.83334 WP_003898693.1.83367 WP_003898693.1.83380 WP_003898693.1.83409 WP_003898693.1.83435 WP_003898693.1.83470 WP_003898693.1.8358 WP_003898693.1.83601 WP_003898693.1.83656 WP_003898693.1.83692 WP_003898693.1.83705 WP_003898693.1.83766 WP_003898693.1.83793 WP_003898693.1.83794 WP_003898693.1.83805 WP_003898693.1.83842 WP_003898693.1.83850 WP_003898693.1.83861 WP_003898693.1.83884 WP_003898693.1.84070 WP_003898693.1.8409 WP_003898693.1.8415 WP_003898693.1.84192 WP_003898693.1.84259 WP_003898693.1.8426 WP_003898693.1.84277 WP_003898693.1.8434 WP_003898693.1.84488 WP_003898693.1.84620 WP_003898693.1.84623 WP_003898693.1.84641 WP_003898693.1.84670 WP_003898693.1.84839 WP_003898693.1.84873 WP_003898693.1.84938 WP_003898693.1.84968 WP_003898693.1.84973 WP_003898693.1.85074 WP_003898693.1.8509 WP_003898693.1.8512 WP_003898693.1.85148 WP_003898693.1.8522 WP_003898693.1.85276 WP_003898693.1.85281 WP_003898693.1.85314 WP_003898693.1.85363 WP_003898693.1.85371 WP_003898693.1.85387 WP_003898693.1.85458 WP_003898693.1.85557 WP_003898693.1.8563 WP_003898693.1.85679 WP_003898693.1.85727 WP_003898693.1.85737 WP_003898693.1.85819 WP_003898693.1.85823 WP_003898693.1.85872 WP_003898693.1.85894 WP_003898693.1.86067 WP_003898693.1.86103 WP_003898693.1.86160 WP_003898693.1.86168 WP_003898693.1.86190 WP_003898693.1.86204 WP_003898693.1.86208 WP_003898693.1.86235 WP_003898693.1.863 WP_003898693.1.86334 WP_003898693.1.86337 WP_003898693.1.8649 WP_003898693.1.86520 WP_003898693.1.86568 WP_003898693.1.86584 WP_003898693.1.86605 WP_003898693.1.86626 WP_003898693.1.86648 WP_003898693.1.86696 WP_003898693.1.86705 WP_003898693.1.86725 WP_003898693.1.86757 WP_003898693.1.86766 WP_003898693.1.86814 WP_003898693.1.86825 WP_003898693.1.86834 WP_003898693.1.86877 WP_003898693.1.86883 WP_003898693.1.8689 WP_003898693.1.86933 WP_003898693.1.86962 WP_003898693.1.87031 WP_003898693.1.87117 WP_003898693.1.87178 WP_003898693.1.87191 WP_003898693.1.87201 WP_003898693.1.87266 WP_003898693.1.87273 WP_003898693.1.8737 WP_003898693.1.87444 WP_003898693.1.87446 WP_003898693.1.87472 WP_003898693.1.87496 WP_003898693.1.87582 WP_003898693.1.87619 WP_003898693.1.87620 WP_003898693.1.8765 WP_003898693.1.87650 WP_003898693.1.87654 WP_003898693.1.87677 WP_003898693.1.87692 WP_003898693.1.87796 WP_003898693.1.87817 WP_003898693.1.87837 WP_003898693.1.87924 WP_003898693.1.87951 WP_003898693.1.87956 WP_003898693.1.88 WP_003898693.1.88002 WP_003898693.1.88037 WP_003898693.1.88072 WP_003898693.1.88077 WP_003898693.1.88121 WP_003898693.1.88294 WP_003898693.1.88316 WP_003898693.1.88338 WP_003898693.1.88453 WP_003898693.1.88469 WP_003898693.1.88507 WP_003898693.1.88530 WP_003898693.1.88541 WP_003898693.1.88618 WP_003898693.1.8862 WP_003898693.1.88632 WP_003898693.1.88634 WP_003898693.1.88649 WP_003898693.1.88824 WP_003898693.1.8902 WP_003898693.1.89025 WP_003898693.1.89041 WP_003898693.1.89046 WP_003898693.1.89082 WP_003898693.1.89168 WP_003898693.1.89207 WP_003898693.1.8925 WP_003898693.1.89277 WP_003898693.1.89286 WP_003898693.1.89320 WP_003898693.1.89371 WP_003898693.1.89392 WP_003898693.1.89406 WP_003898693.1.89451 WP_003898693.1.89453 WP_003898693.1.89473 WP_003898693.1.89475 WP_003898693.1.89483 WP_003898693.1.895 WP_003898693.1.89513 WP_003898693.1.89522 WP_003898693.1.8954 WP_003898693.1.89543 WP_003898693.1.8957 WP_003898693.1.89572 WP_003898693.1.89589 WP_003898693.1.89607 WP_003898693.1.89648 WP_003898693.1.8967 WP_003898693.1.89670 WP_003898693.1.89676 WP_003898693.1.89729 WP_003898693.1.89739 WP_003898693.1.8977 WP_003898693.1.89808 WP_003898693.1.89844 WP_003898693.1.89909 WP_003898693.1.89926 WP_003898693.1.89971 WP_003898693.1.89987 WP_003898693.1.900 WP_003898693.1.90134 WP_003898693.1.90199 WP_003898693.1.90245 WP_003898693.1.90322 WP_003898693.1.90328 WP_003898693.1.90527 WP_003898693.1.90550 WP_003898693.1.90640 WP_003898693.1.90672 WP_003898693.1.90744 WP_003898693.1.9075 WP_003898693.1.90756 WP_003898693.1.90785 WP_003898693.1.90800 WP_003898693.1.90810 WP_003898693.1.9082 WP_003898693.1.90884 WP_003898693.1.90958 WP_003898693.1.90976 WP_003898693.1.90977 WP_003898693.1.90987 WP_003898693.1.91026 WP_003898693.1.91082 WP_003898693.1.91106 WP_003898693.1.91112 WP_003898693.1.91144 WP_003898693.1.91157 WP_003898693.1.91169 WP_003898693.1.91201 WP_003898693.1.91207 WP_003898693.1.91208 WP_003898693.1.91211 WP_003898693.1.91230 WP_003898693.1.91244 WP_003898693.1.91260 WP_003898693.1.91284 WP_003898693.1.91294 WP_003898693.1.91303 WP_003898693.1.91386 WP_003898693.1.9139 WP_003898693.1.91436 WP_003898693.1.91483 WP_003898693.1.91496 WP_003898693.1.91576 WP_003898693.1.91589 WP_003898693.1.91695 WP_003898693.1.91728 WP_003898693.1.91759 WP_003898693.1.91786 WP_003898693.1.91802 WP_003898693.1.91822 WP_003898693.1.91828 WP_003898693.1.9190 WP_003898693.1.91915 WP_003898693.1.91944 WP_003898693.1.91953 WP_003898693.1.92192 WP_003898693.1.92200 WP_003898693.1.92289 WP_003898693.1.9229 WP_003898693.1.92294 WP_003898693.1.92300 WP_003898693.1.92334 WP_003898693.1.92338 WP_003898693.1.92345 WP_003898693.1.92456 WP_003898693.1.92508 WP_003898693.1.92511 WP_003898693.1.92536 WP_003898693.1.92592 WP_003898693.1.92603 WP_003898693.1.92606 WP_003898693.1.9263 WP_003898693.1.92685 WP_003898693.1.92690 WP_003898693.1.92714 WP_003898693.1.92760 WP_003898693.1.92833 WP_003898693.1.92881 WP_003898693.1.92908 WP_003898693.1.9291 WP_003898693.1.93006 WP_003898693.1.93009 WP_003898693.1.9307 WP_003898693.1.93083 WP_003898693.1.93097 WP_003898693.1.93192 WP_003898693.1.93203 WP_003898693.1.93212 WP_003898693.1.93245 WP_003898693.1.93265 WP_003898693.1.93297 WP_003898693.1.93320 WP_003898693.1.93363 WP_003898693.1.93417 WP_003898693.1.93426 WP_003898693.1.93447 WP_003898693.1.93470 WP_003898693.1.93483 WP_003898693.1.93487 WP_003898693.1.93536 WP_003898693.1.93555 WP_003898693.1.93560 WP_003898693.1.9357 WP_003898693.1.93573 WP_003898693.1.93576 WP_003898693.1.93588 WP_003898693.1.93645 WP_003898693.1.93649 WP_003898693.1.93677 WP_003898693.1.9368 WP_003898693.1.93698 WP_003898693.1.93706 WP_003898693.1.9371 WP_003898693.1.93792 WP_003898693.1.93871 WP_003898693.1.93946 WP_003898693.1.93950 WP_003898693.1.93953 WP_003898693.1.93954 WP_003898693.1.93988 WP_003898693.1.9407 WP_003898693.1.94143 WP_003898693.1.94281 WP_003898693.1.9431 WP_003898693.1.94416 WP_003898693.1.94512 WP_003898693.1.94528 WP_003898693.1.94564 WP_003898693.1.94623 WP_003898693.1.94714 WP_003898693.1.94730 WP_003898693.1.9478 WP_003898693.1.94834 WP_003898693.1.9488 WP_003898693.1.94916 WP_003898693.1.94996 WP_003898693.1.94998 WP_003898693.1.95082 WP_003898693.1.95096 WP_003898693.1.95138 WP_003898693.1.95188 WP_003898693.1.95234 WP_003898693.1.95241 WP_003898693.1.95245 WP_003898693.1.95257 WP_003898693.1.95279 WP_003898693.1.95335 WP_003898693.1.9535 WP_003898693.1.95491 WP_003898693.1.95508 WP_003898693.1.95509 WP_003898693.1.95529 WP_003898693.1.95557 WP_003898693.1.95578 WP_003898693.1.95585 WP_003898693.1.95643 WP_003898693.1.95679 WP_003898693.1.957 WP_003898693.1.95724 WP_003898693.1.95730 WP_003898693.1.95735 WP_003898693.1.95772 WP_003898693.1.95797 WP_003898693.1.9585 WP_003898693.1.95902 WP_003898693.1.95924 WP_003898693.1.95926 WP_003898693.1.95958 WP_003898693.1.96006 WP_003898693.1.9602 WP_003898693.1.96036 WP_003898693.1.96098 WP_003898693.1.96146 WP_003898693.1.96230 WP_003898693.1.96242 WP_003898693.1.96245 WP_003898693.1.96313 WP_003898693.1.96318 WP_003898693.1.96345 WP_003898693.1.96360 WP_003898693.1.96373 WP_003898693.1.96576 WP_003898693.1.96621 WP_003898693.1.9667 WP_003898693.1.96681 WP_003898693.1.96754 WP_003898693.1.97008 WP_003898693.1.97009 WP_003898693.1.97084 WP_003898693.1.97087 WP_003898693.1.97094 WP_003898693.1.97113 WP_003898693.1.97122 WP_003898693.1.97136 WP_003898693.1.97237 WP_003898693.1.97242 WP_003898693.1.97270 WP_003898693.1.97283 WP_003898693.1.97321 WP_003898693.1.97376 WP_003898693.1.97380 WP_003898693.1.97462 WP_003898693.1.97517 WP_003898693.1.97519 WP_003898693.1.97591 WP_003898693.1.97609 WP_003898693.1.9763 WP_003898693.1.97673 WP_003898693.1.97700 WP_003898693.1.97701 WP_003898693.1.97730 WP_003898693.1.97740 WP_003898693.1.97751 WP_003898693.1.9784 WP_003898693.1.97888 WP_003898693.1.9795 WP_003898693.1.97958 WP_003898693.1.97966 WP_003898693.1.98018 WP_003898693.1.98052 WP_003898693.1.98072 WP_003898693.1.98114 WP_003898693.1.98189 WP_003898693.1.98291 WP_003898693.1.98335 WP_003898693.1.98412 WP_003898693.1.98443 WP_003898693.1.98486 WP_003898693.1.98488 WP_003898693.1.98516 WP_003898693.1.98536 WP_003898693.1.98541 WP_003898693.1.98594 WP_003898693.1.98599 WP_003898693.1.98646 WP_003898693.1.98656 WP_003898693.1.98674 WP_003898693.1.98697 WP_003898693.1.98701 WP_003898693.1.98749 WP_003898693.1.98765 WP_003898693.1.98777 WP_003898693.1.98778 WP_003898693.1.98802 WP_003898693.1.98838 WP_003898693.1.98984 WP_003898693.1.99000 WP_003898693.1.99023 WP_003898693.1.99055 WP_003898693.1.99161 WP_003898693.1.99216 WP_003898693.1.99222 WP_003898693.1.99294 WP_003898693.1.99312 WP_003898693.1.99315 WP_003898693.1.99328 WP_003898693.1.99365 WP_003898693.1.99396 WP_003898693.1.99402 WP_003898693.1.99419 WP_003898693.1.99473 WP_003898693.1.99529 WP_003898693.1.99548 WP_003898693.1.99617 WP_003898693.1.99650 WP_003898693.1.99711 WP_003898693.1.99716 WP_003898693.1.99740 WP_003898693.1.9976 WP_003898693.1.99847 WP_003898693.1.99852 WP_003898693.1.99915 WP_003898693.1.99991 gi|148660805|ref|YP_001282328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]