SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 336982.TBFG_11722 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  336982.TBFG_11722
Domain Number 1 Region: 390-468
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000903
Family Anti-sigma factor antagonist SpoIIaa 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 336982.TBFG_11722
Sequence length 486
Comment (Mycobacterium tuberculosis F11)
Sequence
MLQRIARELLSGVAVAIVALPLAIAFGITATGTSQGALIGLYGAIFAGFFAAVFGGTPGQ
VTGPTGPITVVATATIAEHGLEGAFFAFILAGVFQILFGACRLGSLIRYVPHPVISGFMG
GIAILIIMTQLDQVRSSSLLVLVTVVLLLASGRFIKAIPPSLLVLVLVSSVLPLAAPWLR
DLRAGPVSINRTVDYIGEIPQAMPSFDFPQVANSTMLQVLLSAVAIALLGSLDSLLTSLV
MDNIRGTRHRSNKELIGQGIGNIAAGLFGGLSGAGATVRSVVNVRNGGQTALSAATHSVV
LFVFVAGLGAVVQYIPLAVLSGILILVAVGMFDWHAMRKAHVSPRGDVIVMFTTMIITVV
VDLTIAVMVGIALSLLVHRLRSRQRKAKVTQDDTGTYRIDGPLSFLSVDGVFGSLRDGRE
DVSLDLQHVTYLDTSGARALLYFIDHSEKDGVAVSIKRIPPRLESQLTALADNEQRDKLR
TVLESA
Download sequence
Identical sequences A0A045KIY6 A0A089QSV0 A0A0H3L9T3 A5U366 L7N616 O33206 R4MGT9
gi|385998483|ref|YP_005916781.1| gi|253799254|ref|YP_003032255.1| gi|479055662|ref|YP_007351468.1| gi|506926186|ref|YP_008006636.1| NP_216223.1.84033 WP_003898981.1.100021 WP_003898981.1.100087 WP_003898981.1.10015 WP_003898981.1.100208 WP_003898981.1.100216 WP_003898981.1.10022 WP_003898981.1.100255 WP_003898981.1.100260 WP_003898981.1.100270 WP_003898981.1.100279 WP_003898981.1.100286 WP_003898981.1.100308 WP_003898981.1.100309 WP_003898981.1.100318 WP_003898981.1.100338 WP_003898981.1.10037 WP_003898981.1.100396 WP_003898981.1.1004 WP_003898981.1.100401 WP_003898981.1.100459 WP_003898981.1.100460 WP_003898981.1.100552 WP_003898981.1.100581 WP_003898981.1.100600 WP_003898981.1.100625 WP_003898981.1.10064 WP_003898981.1.100666 WP_003898981.1.100671 WP_003898981.1.100677 WP_003898981.1.100697 WP_003898981.1.100703 WP_003898981.1.100716 WP_003898981.1.100722 WP_003898981.1.100754 WP_003898981.1.100757 WP_003898981.1.100772 WP_003898981.1.1008 WP_003898981.1.100812 WP_003898981.1.100845 WP_003898981.1.100866 WP_003898981.1.10088 WP_003898981.1.100889 WP_003898981.1.10090 WP_003898981.1.100910 WP_003898981.1.100915 WP_003898981.1.100918 WP_003898981.1.100935 WP_003898981.1.100984 WP_003898981.1.100992 WP_003898981.1.100998 WP_003898981.1.101 WP_003898981.1.101025 WP_003898981.1.101028 WP_003898981.1.10104 WP_003898981.1.101048 WP_003898981.1.101054 WP_003898981.1.101075 WP_003898981.1.101143 WP_003898981.1.10116 WP_003898981.1.10117 WP_003898981.1.101209 WP_003898981.1.10125 WP_003898981.1.101290 WP_003898981.1.101323 WP_003898981.1.101324 WP_003898981.1.101350 WP_003898981.1.101367 WP_003898981.1.101398 WP_003898981.1.101403 WP_003898981.1.101421 WP_003898981.1.10144 WP_003898981.1.101442 WP_003898981.1.10145 WP_003898981.1.101452 WP_003898981.1.101456 WP_003898981.1.101481 WP_003898981.1.101493 WP_003898981.1.101496 WP_003898981.1.101525 WP_003898981.1.101533 WP_003898981.1.101535 WP_003898981.1.101553 WP_003898981.1.101558 WP_003898981.1.10156 WP_003898981.1.101573 WP_003898981.1.101576 WP_003898981.1.10159 WP_003898981.1.101592 WP_003898981.1.101604 WP_003898981.1.101607 WP_003898981.1.101622 WP_003898981.1.101644 WP_003898981.1.101659 WP_003898981.1.101671 WP_003898981.1.101687 WP_003898981.1.101698 WP_003898981.1.10170 WP_003898981.1.101713 WP_003898981.1.101722 WP_003898981.1.101733 WP_003898981.1.101743 WP_003898981.1.101753 WP_003898981.1.101754 WP_003898981.1.101764 WP_003898981.1.101773 WP_003898981.1.101795 WP_003898981.1.101797 WP_003898981.1.101798 WP_003898981.1.101802 WP_003898981.1.101826 WP_003898981.1.101836 WP_003898981.1.101858 WP_003898981.1.101859 WP_003898981.1.101862 WP_003898981.1.101888 WP_003898981.1.101894 WP_003898981.1.101899 WP_003898981.1.1019 WP_003898981.1.101923 WP_003898981.1.101925 WP_003898981.1.10193 WP_003898981.1.102 WP_003898981.1.102008 WP_003898981.1.102017 WP_003898981.1.102053 WP_003898981.1.102055 WP_003898981.1.102063 WP_003898981.1.102099 WP_003898981.1.1021 WP_003898981.1.10211 WP_003898981.1.102119 WP_003898981.1.102121 WP_003898981.1.102143 WP_003898981.1.10216 WP_003898981.1.10224 WP_003898981.1.10253 WP_003898981.1.10262 WP_003898981.1.10272 WP_003898981.1.1033 WP_003898981.1.10350 WP_003898981.1.10362 WP_003898981.1.10366 WP_003898981.1.10376 WP_003898981.1.10396 WP_003898981.1.10410 WP_003898981.1.10430 WP_003898981.1.1044 WP_003898981.1.10440 WP_003898981.1.10445 WP_003898981.1.10471 WP_003898981.1.10472 WP_003898981.1.10489 WP_003898981.1.105 WP_003898981.1.10518 WP_003898981.1.10523 WP_003898981.1.10545 WP_003898981.1.1057 WP_003898981.1.10594 WP_003898981.1.10603 WP_003898981.1.10606 WP_003898981.1.10615 WP_003898981.1.10623 WP_003898981.1.10635 WP_003898981.1.10643 WP_003898981.1.10648 WP_003898981.1.10709 WP_003898981.1.10735 WP_003898981.1.10740 WP_003898981.1.10756 WP_003898981.1.1078 WP_003898981.1.10791 WP_003898981.1.10799 WP_003898981.1.10825 WP_003898981.1.10848 WP_003898981.1.10863 WP_003898981.1.10879 WP_003898981.1.10912 WP_003898981.1.10916 WP_003898981.1.10923 WP_003898981.1.10927 WP_003898981.1.1095 WP_003898981.1.10956 WP_003898981.1.10958 WP_003898981.1.10962 WP_003898981.1.10980 WP_003898981.1.10981 WP_003898981.1.10993 WP_003898981.1.1100 WP_003898981.1.11061 WP_003898981.1.11070 WP_003898981.1.11171 WP_003898981.1.11175 WP_003898981.1.11176 WP_003898981.1.11222 WP_003898981.1.11236 WP_003898981.1.11329 WP_003898981.1.1133 WP_003898981.1.11342 WP_003898981.1.11373 WP_003898981.1.11376 WP_003898981.1.11390 WP_003898981.1.11402 WP_003898981.1.11481 WP_003898981.1.11487 WP_003898981.1.11489 WP_003898981.1.11589 WP_003898981.1.11596 WP_003898981.1.11610 WP_003898981.1.11697 WP_003898981.1.11707 WP_003898981.1.11752 WP_003898981.1.11758 WP_003898981.1.11761 WP_003898981.1.11775 WP_003898981.1.11804 WP_003898981.1.11822 WP_003898981.1.11856 WP_003898981.1.11898 WP_003898981.1.11906 WP_003898981.1.11939 WP_003898981.1.11960 WP_003898981.1.11961 WP_003898981.1.120 WP_003898981.1.12001 WP_003898981.1.12049 WP_003898981.1.12052 WP_003898981.1.12116 WP_003898981.1.12161 WP_003898981.1.12165 WP_003898981.1.12184 WP_003898981.1.12190 WP_003898981.1.12216 WP_003898981.1.12265 WP_003898981.1.12275 WP_003898981.1.12293 WP_003898981.1.12294 WP_003898981.1.123 WP_003898981.1.1231 WP_003898981.1.12314 WP_003898981.1.12327 WP_003898981.1.12338 WP_003898981.1.1236 WP_003898981.1.12371 WP_003898981.1.12372 WP_003898981.1.12389 WP_003898981.1.12406 WP_003898981.1.1241 WP_003898981.1.12421 WP_003898981.1.12446 WP_003898981.1.12464 WP_003898981.1.12479 WP_003898981.1.12519 WP_003898981.1.12523 WP_003898981.1.12526 WP_003898981.1.1255 WP_003898981.1.12551 WP_003898981.1.12563 WP_003898981.1.12611 WP_003898981.1.12669 WP_003898981.1.1267 WP_003898981.1.12672 WP_003898981.1.12692 WP_003898981.1.1271 WP_003898981.1.12768 WP_003898981.1.1279 WP_003898981.1.12794 WP_003898981.1.12804 WP_003898981.1.12821 WP_003898981.1.12841 WP_003898981.1.12854 WP_003898981.1.12871 WP_003898981.1.12901 WP_003898981.1.12941 WP_003898981.1.12947 WP_003898981.1.12957 WP_003898981.1.12972 WP_003898981.1.13028 WP_003898981.1.13043 WP_003898981.1.13086 WP_003898981.1.13087 WP_003898981.1.13090 WP_003898981.1.13096 WP_003898981.1.13163 WP_003898981.1.13175 WP_003898981.1.132 WP_003898981.1.13249 WP_003898981.1.13282 WP_003898981.1.13284 WP_003898981.1.13296 WP_003898981.1.13298 WP_003898981.1.13306 WP_003898981.1.13312 WP_003898981.1.13313 WP_003898981.1.13321 WP_003898981.1.13345 WP_003898981.1.13358 WP_003898981.1.13370 WP_003898981.1.13375 WP_003898981.1.1338 WP_003898981.1.13420 WP_003898981.1.13433 WP_003898981.1.13435 WP_003898981.1.13438 WP_003898981.1.13461 WP_003898981.1.13466 WP_003898981.1.13489 WP_003898981.1.13551 WP_003898981.1.13561 WP_003898981.1.13564 WP_003898981.1.13579 WP_003898981.1.13647 WP_003898981.1.13687 WP_003898981.1.13697 WP_003898981.1.13719 WP_003898981.1.13763 WP_003898981.1.1377 WP_003898981.1.13774 WP_003898981.1.13786 WP_003898981.1.13793 WP_003898981.1.13794 WP_003898981.1.13817 WP_003898981.1.13834 WP_003898981.1.13866 WP_003898981.1.13880 WP_003898981.1.13899 WP_003898981.1.13909 WP_003898981.1.13910 WP_003898981.1.13919 WP_003898981.1.13920 WP_003898981.1.13953 WP_003898981.1.13962 WP_003898981.1.1398 WP_003898981.1.13988 WP_003898981.1.14027 WP_003898981.1.14046 WP_003898981.1.14115 WP_003898981.1.1415 WP_003898981.1.14152 WP_003898981.1.14158 WP_003898981.1.14175 WP_003898981.1.14178 WP_003898981.1.14194 WP_003898981.1.14195 WP_003898981.1.14208 WP_003898981.1.14238 WP_003898981.1.14266 WP_003898981.1.14273 WP_003898981.1.14303 WP_003898981.1.14307 WP_003898981.1.14310 WP_003898981.1.14382 WP_003898981.1.14416 WP_003898981.1.14428 WP_003898981.1.14441 WP_003898981.1.14469 WP_003898981.1.14477 WP_003898981.1.14514 WP_003898981.1.1452 WP_003898981.1.14527 WP_003898981.1.1454 WP_003898981.1.14544 WP_003898981.1.14548 WP_003898981.1.14551 WP_003898981.1.14561 WP_003898981.1.14573 WP_003898981.1.14668 WP_003898981.1.14675 WP_003898981.1.14694 WP_003898981.1.14695 WP_003898981.1.14709 WP_003898981.1.14766 WP_003898981.1.14783 WP_003898981.1.14865 WP_003898981.1.14872 WP_003898981.1.14905 WP_003898981.1.14951 WP_003898981.1.14955 WP_003898981.1.15003 WP_003898981.1.15009 WP_003898981.1.15028 WP_003898981.1.15040 WP_003898981.1.15052 WP_003898981.1.15065 WP_003898981.1.15072 WP_003898981.1.15089 WP_003898981.1.1509 WP_003898981.1.15126 WP_003898981.1.15131 WP_003898981.1.15168 WP_003898981.1.15174 WP_003898981.1.15187 WP_003898981.1.15196 WP_003898981.1.15210 WP_003898981.1.15216 WP_003898981.1.15217 WP_003898981.1.1523 WP_003898981.1.15232 WP_003898981.1.15238 WP_003898981.1.15240 WP_003898981.1.15253 WP_003898981.1.1527 WP_003898981.1.15292 WP_003898981.1.15299 WP_003898981.1.15302 WP_003898981.1.15322 WP_003898981.1.1534 WP_003898981.1.15365 WP_003898981.1.15386 WP_003898981.1.15387 WP_003898981.1.15442 WP_003898981.1.15447 WP_003898981.1.15477 WP_003898981.1.15481 WP_003898981.1.15492 WP_003898981.1.15511 WP_003898981.1.15512 WP_003898981.1.15558 WP_003898981.1.15559 WP_003898981.1.15566 WP_003898981.1.15599 WP_003898981.1.1560 WP_003898981.1.15611 WP_003898981.1.1563 WP_003898981.1.15633 WP_003898981.1.15643 WP_003898981.1.15688 WP_003898981.1.15755 WP_003898981.1.15763 WP_003898981.1.15774 WP_003898981.1.1578 WP_003898981.1.15780 WP_003898981.1.15834 WP_003898981.1.15842 WP_003898981.1.15853 WP_003898981.1.15870 WP_003898981.1.15877 WP_003898981.1.15893 WP_003898981.1.15896 WP_003898981.1.15926 WP_003898981.1.15933 WP_003898981.1.15946 WP_003898981.1.15958 WP_003898981.1.15973 WP_003898981.1.15987 WP_003898981.1.15993 WP_003898981.1.16009 WP_003898981.1.16025 WP_003898981.1.16043 WP_003898981.1.16066 WP_003898981.1.16069 WP_003898981.1.16077 WP_003898981.1.16106 WP_003898981.1.16108 WP_003898981.1.16130 WP_003898981.1.16136 WP_003898981.1.16139 WP_003898981.1.16141 WP_003898981.1.1630 WP_003898981.1.16318 WP_003898981.1.1632 WP_003898981.1.16327 WP_003898981.1.16334 WP_003898981.1.16341 WP_003898981.1.16345 WP_003898981.1.16374 WP_003898981.1.16384 WP_003898981.1.16386 WP_003898981.1.164 WP_003898981.1.1642 WP_003898981.1.16424 WP_003898981.1.16431 WP_003898981.1.1644 WP_003898981.1.16442 WP_003898981.1.16448 WP_003898981.1.16451 WP_003898981.1.16476 WP_003898981.1.16480 WP_003898981.1.16494 WP_003898981.1.1652 WP_003898981.1.16549 WP_003898981.1.16560 WP_003898981.1.16598 WP_003898981.1.16609 WP_003898981.1.16619 WP_003898981.1.16620 WP_003898981.1.16622 WP_003898981.1.16637 WP_003898981.1.1669 WP_003898981.1.16724 WP_003898981.1.16731 WP_003898981.1.16743 WP_003898981.1.1683 WP_003898981.1.16837 WP_003898981.1.16852 WP_003898981.1.16937 WP_003898981.1.16940 WP_003898981.1.16950 WP_003898981.1.16959 WP_003898981.1.1697 WP_003898981.1.16987 WP_003898981.1.17005 WP_003898981.1.17006 WP_003898981.1.17010 WP_003898981.1.17015 WP_003898981.1.17019 WP_003898981.1.17041 WP_003898981.1.17052 WP_003898981.1.17057 WP_003898981.1.17062 WP_003898981.1.1707 WP_003898981.1.17094 WP_003898981.1.17130 WP_003898981.1.17138 WP_003898981.1.17147 WP_003898981.1.17224 WP_003898981.1.17251 WP_003898981.1.17288 WP_003898981.1.17304 WP_003898981.1.17345 WP_003898981.1.17381 WP_003898981.1.17391 WP_003898981.1.1743 WP_003898981.1.17440 WP_003898981.1.17466 WP_003898981.1.17477 WP_003898981.1.17483 WP_003898981.1.17540 WP_003898981.1.17553 WP_003898981.1.17558 WP_003898981.1.17599 WP_003898981.1.17635 WP_003898981.1.17655 WP_003898981.1.17679 WP_003898981.1.17700 WP_003898981.1.17710 WP_003898981.1.17713 WP_003898981.1.17722 WP_003898981.1.17746 WP_003898981.1.17788 WP_003898981.1.17798 WP_003898981.1.17803 WP_003898981.1.17816 WP_003898981.1.17830 WP_003898981.1.17868 WP_003898981.1.17878 WP_003898981.1.1792 WP_003898981.1.17923 WP_003898981.1.1795 WP_003898981.1.17955 WP_003898981.1.17973 WP_003898981.1.18009 WP_003898981.1.18033 WP_003898981.1.18057 WP_003898981.1.18065 WP_003898981.1.18070 WP_003898981.1.18116 WP_003898981.1.18120 WP_003898981.1.18126 WP_003898981.1.1817 WP_003898981.1.18170 WP_003898981.1.18206 WP_003898981.1.18216 WP_003898981.1.18240 WP_003898981.1.18257 WP_003898981.1.18297 WP_003898981.1.18306 WP_003898981.1.18364 WP_003898981.1.18399 WP_003898981.1.18444 WP_003898981.1.18448 WP_003898981.1.18467 WP_003898981.1.18476 WP_003898981.1.18522 WP_003898981.1.18580 WP_003898981.1.18582 WP_003898981.1.186 WP_003898981.1.18601 WP_003898981.1.18639 WP_003898981.1.18646 WP_003898981.1.18647 WP_003898981.1.18694 WP_003898981.1.18710 WP_003898981.1.18751 WP_003898981.1.18781 WP_003898981.1.18793 WP_003898981.1.18804 WP_003898981.1.18816 WP_003898981.1.18823 WP_003898981.1.18827 WP_003898981.1.18838 WP_003898981.1.18849 WP_003898981.1.18856 WP_003898981.1.18945 WP_003898981.1.1898 WP_003898981.1.19005 WP_003898981.1.19056 WP_003898981.1.19066 WP_003898981.1.19071 WP_003898981.1.19085 WP_003898981.1.19094 WP_003898981.1.19144 WP_003898981.1.19159 WP_003898981.1.19193 WP_003898981.1.19231 WP_003898981.1.19243 WP_003898981.1.19264 WP_003898981.1.19295 WP_003898981.1.19307 WP_003898981.1.19326 WP_003898981.1.1933 WP_003898981.1.19364 WP_003898981.1.19400 WP_003898981.1.19426 WP_003898981.1.19429 WP_003898981.1.19480 WP_003898981.1.19553 WP_003898981.1.19562 WP_003898981.1.19564 WP_003898981.1.19568 WP_003898981.1.19572 WP_003898981.1.19595 WP_003898981.1.19596 WP_003898981.1.19600 WP_003898981.1.19630 WP_003898981.1.1967 WP_003898981.1.19694 WP_003898981.1.1970 WP_003898981.1.19707 WP_003898981.1.19742 WP_003898981.1.19785 WP_003898981.1.19820 WP_003898981.1.19868 WP_003898981.1.19874 WP_003898981.1.19890 WP_003898981.1.19900 WP_003898981.1.19922 WP_003898981.1.19936 WP_003898981.1.19946 WP_003898981.1.19949 WP_003898981.1.19960 WP_003898981.1.19964 WP_003898981.1.20007 WP_003898981.1.20016 WP_003898981.1.2003 WP_003898981.1.20037 WP_003898981.1.20039 WP_003898981.1.20082 WP_003898981.1.20085 WP_003898981.1.20097 WP_003898981.1.20116 WP_003898981.1.20130 WP_003898981.1.20140 WP_003898981.1.20141 WP_003898981.1.20142 WP_003898981.1.20239 WP_003898981.1.20243 WP_003898981.1.20259 WP_003898981.1.20262 WP_003898981.1.20272 WP_003898981.1.20280 WP_003898981.1.20294 WP_003898981.1.20300 WP_003898981.1.20309 WP_003898981.1.20322 WP_003898981.1.2037 WP_003898981.1.20372 WP_003898981.1.20381 WP_003898981.1.20427 WP_003898981.1.20457 WP_003898981.1.20459 WP_003898981.1.20460 WP_003898981.1.20578 WP_003898981.1.20608 WP_003898981.1.20624 WP_003898981.1.20628 WP_003898981.1.2066 WP_003898981.1.20707 WP_003898981.1.20722 WP_003898981.1.20729 WP_003898981.1.20742 WP_003898981.1.20751 WP_003898981.1.20776 WP_003898981.1.20843 WP_003898981.1.20850 WP_003898981.1.2086 WP_003898981.1.20868 WP_003898981.1.20876 WP_003898981.1.20897 WP_003898981.1.20898 WP_003898981.1.2090 WP_003898981.1.20911 WP_003898981.1.20921 WP_003898981.1.20926 WP_003898981.1.20927 WP_003898981.1.20951 WP_003898981.1.20970 WP_003898981.1.2104 WP_003898981.1.21070 WP_003898981.1.21127 WP_003898981.1.21135 WP_003898981.1.21173 WP_003898981.1.21187 WP_003898981.1.212 WP_003898981.1.2120 WP_003898981.1.21218 WP_003898981.1.21219 WP_003898981.1.2123 WP_003898981.1.21231 WP_003898981.1.21292 WP_003898981.1.21307 WP_003898981.1.2131 WP_003898981.1.21311 WP_003898981.1.21321 WP_003898981.1.21392 WP_003898981.1.21397 WP_003898981.1.21403 WP_003898981.1.21415 WP_003898981.1.21430 WP_003898981.1.21434 WP_003898981.1.21444 WP_003898981.1.21468 WP_003898981.1.21498 WP_003898981.1.21509 WP_003898981.1.21513 WP_003898981.1.21560 WP_003898981.1.21565 WP_003898981.1.21586 WP_003898981.1.21591 WP_003898981.1.21594 WP_003898981.1.21602 WP_003898981.1.21615 WP_003898981.1.21638 WP_003898981.1.21639 WP_003898981.1.21655 WP_003898981.1.21658 WP_003898981.1.2168 WP_003898981.1.2174 WP_003898981.1.21741 WP_003898981.1.21777 WP_003898981.1.21786 WP_003898981.1.21795 WP_003898981.1.218 WP_003898981.1.21826 WP_003898981.1.21829 WP_003898981.1.21840 WP_003898981.1.21843 WP_003898981.1.21872 WP_003898981.1.21873 WP_003898981.1.2188 WP_003898981.1.21882 WP_003898981.1.21906 WP_003898981.1.21912 WP_003898981.1.2194 WP_003898981.1.21941 WP_003898981.1.21956 WP_003898981.1.21958 WP_003898981.1.21960 WP_003898981.1.21971 WP_003898981.1.21973 WP_003898981.1.21983 WP_003898981.1.22003 WP_003898981.1.22013 WP_003898981.1.22025 WP_003898981.1.22036 WP_003898981.1.22075 WP_003898981.1.22092 WP_003898981.1.2212 WP_003898981.1.22127 WP_003898981.1.22140 WP_003898981.1.22233 WP_003898981.1.22255 WP_003898981.1.22277 WP_003898981.1.22348 WP_003898981.1.22366 WP_003898981.1.2238 WP_003898981.1.22380 WP_003898981.1.22437 WP_003898981.1.22438 WP_003898981.1.22511 WP_003898981.1.22524 WP_003898981.1.22585 WP_003898981.1.22606 WP_003898981.1.22608 WP_003898981.1.22609 WP_003898981.1.22618 WP_003898981.1.2262 WP_003898981.1.22624 WP_003898981.1.22629 WP_003898981.1.22647 WP_003898981.1.22664 WP_003898981.1.22665 WP_003898981.1.22670 WP_003898981.1.22725 WP_003898981.1.22728 WP_003898981.1.22733 WP_003898981.1.22737 WP_003898981.1.2275 WP_003898981.1.22754 WP_003898981.1.22800 WP_003898981.1.22804 WP_003898981.1.22829 WP_003898981.1.22840 WP_003898981.1.22844 WP_003898981.1.22970 WP_003898981.1.22996 WP_003898981.1.22997 WP_003898981.1.22999 WP_003898981.1.23015 WP_003898981.1.23032 WP_003898981.1.231 WP_003898981.1.23101 WP_003898981.1.2312 WP_003898981.1.23153 WP_003898981.1.23171 WP_003898981.1.23199 WP_003898981.1.2320 WP_003898981.1.23204 WP_003898981.1.23216 WP_003898981.1.23229 WP_003898981.1.23233 WP_003898981.1.2326 WP_003898981.1.23261 WP_003898981.1.23272 WP_003898981.1.23289 WP_003898981.1.2329 WP_003898981.1.23308 WP_003898981.1.23321 WP_003898981.1.23325 WP_003898981.1.2339 WP_003898981.1.23406 WP_003898981.1.23445 WP_003898981.1.23447 WP_003898981.1.23452 WP_003898981.1.23461 WP_003898981.1.2349 WP_003898981.1.23496 WP_003898981.1.23506 WP_003898981.1.23530 WP_003898981.1.23546 WP_003898981.1.23551 WP_003898981.1.23573 WP_003898981.1.23583 WP_003898981.1.23588 WP_003898981.1.23628 WP_003898981.1.23677 WP_003898981.1.23683 WP_003898981.1.23692 WP_003898981.1.23694 WP_003898981.1.23699 WP_003898981.1.2371 WP_003898981.1.23807 WP_003898981.1.23825 WP_003898981.1.23832 WP_003898981.1.2384 WP_003898981.1.23843 WP_003898981.1.23863 WP_003898981.1.23894 WP_003898981.1.23993 WP_003898981.1.2400 WP_003898981.1.24007 WP_003898981.1.24008 WP_003898981.1.24046 WP_003898981.1.24057 WP_003898981.1.24113 WP_003898981.1.24119 WP_003898981.1.24140 WP_003898981.1.24176 WP_003898981.1.24190 WP_003898981.1.24202 WP_003898981.1.24284 WP_003898981.1.24294 WP_003898981.1.24357 WP_003898981.1.24396 WP_003898981.1.24423 WP_003898981.1.2443 WP_003898981.1.24446 WP_003898981.1.24461 WP_003898981.1.24500 WP_003898981.1.24507 WP_003898981.1.24509 WP_003898981.1.24529 WP_003898981.1.24553 WP_003898981.1.24599 WP_003898981.1.24638 WP_003898981.1.24648 WP_003898981.1.2466 WP_003898981.1.24824 WP_003898981.1.24831 WP_003898981.1.24848 WP_003898981.1.24857 WP_003898981.1.2487 WP_003898981.1.24893 WP_003898981.1.24933 WP_003898981.1.24956 WP_003898981.1.24958 WP_003898981.1.24985 WP_003898981.1.2499 WP_003898981.1.25004 WP_003898981.1.25051 WP_003898981.1.2507 WP_003898981.1.25096 WP_003898981.1.25103 WP_003898981.1.25129 WP_003898981.1.25171 WP_003898981.1.25184 WP_003898981.1.25247 WP_003898981.1.25278 WP_003898981.1.25309 WP_003898981.1.25313 WP_003898981.1.25338 WP_003898981.1.25342 WP_003898981.1.25343 WP_003898981.1.25367 WP_003898981.1.25393 WP_003898981.1.25406 WP_003898981.1.25435 WP_003898981.1.25437 WP_003898981.1.25445 WP_003898981.1.25455 WP_003898981.1.25473 WP_003898981.1.25504 WP_003898981.1.25513 WP_003898981.1.25542 WP_003898981.1.25579 WP_003898981.1.25594 WP_003898981.1.25606 WP_003898981.1.25645 WP_003898981.1.2566 WP_003898981.1.25673 WP_003898981.1.25693 WP_003898981.1.25699 WP_003898981.1.25727 WP_003898981.1.25736 WP_003898981.1.25738 WP_003898981.1.25756 WP_003898981.1.25759 WP_003898981.1.2580 WP_003898981.1.25813 WP_003898981.1.25854 WP_003898981.1.25874 WP_003898981.1.25885 WP_003898981.1.25892 WP_003898981.1.25906 WP_003898981.1.25914 WP_003898981.1.25916 WP_003898981.1.2594 WP_003898981.1.25954 WP_003898981.1.25972 WP_003898981.1.26017 WP_003898981.1.26032 WP_003898981.1.26038 WP_003898981.1.26072 WP_003898981.1.26089 WP_003898981.1.26097 WP_003898981.1.26098 WP_003898981.1.26108 WP_003898981.1.26109 WP_003898981.1.26118 WP_003898981.1.26126 WP_003898981.1.2614 WP_003898981.1.26168 WP_003898981.1.26182 WP_003898981.1.26190 WP_003898981.1.2620 WP_003898981.1.26267 WP_003898981.1.26292 WP_003898981.1.26310 WP_003898981.1.26328 WP_003898981.1.26349 WP_003898981.1.26366 WP_003898981.1.26374 WP_003898981.1.26407 WP_003898981.1.26454 WP_003898981.1.26464 WP_003898981.1.2653 WP_003898981.1.26560 WP_003898981.1.26571 WP_003898981.1.26597 WP_003898981.1.26603 WP_003898981.1.26629 WP_003898981.1.26651 WP_003898981.1.26702 WP_003898981.1.26707 WP_003898981.1.26737 WP_003898981.1.26738 WP_003898981.1.26745 WP_003898981.1.26756 WP_003898981.1.2676 WP_003898981.1.2677 WP_003898981.1.26779 WP_003898981.1.26780 WP_003898981.1.26854 WP_003898981.1.26868 WP_003898981.1.26914 WP_003898981.1.26945 WP_003898981.1.26959 WP_003898981.1.26969 WP_003898981.1.26984 WP_003898981.1.26992 WP_003898981.1.27017 WP_003898981.1.27045 WP_003898981.1.27074 WP_003898981.1.27075 WP_003898981.1.27128 WP_003898981.1.27130 WP_003898981.1.27139 WP_003898981.1.27152 WP_003898981.1.27162 WP_003898981.1.27164 WP_003898981.1.27193 WP_003898981.1.27235 WP_003898981.1.27343 WP_003898981.1.27352 WP_003898981.1.27369 WP_003898981.1.27391 WP_003898981.1.27398 WP_003898981.1.27402 WP_003898981.1.27410 WP_003898981.1.27411 WP_003898981.1.27449 WP_003898981.1.27460 WP_003898981.1.27463 WP_003898981.1.2749 WP_003898981.1.27492 WP_003898981.1.27528 WP_003898981.1.27541 WP_003898981.1.27576 WP_003898981.1.27582 WP_003898981.1.27596 WP_003898981.1.27607 WP_003898981.1.2766 WP_003898981.1.277 WP_003898981.1.27724 WP_003898981.1.27730 WP_003898981.1.27736 WP_003898981.1.27743 WP_003898981.1.27750 WP_003898981.1.27771 WP_003898981.1.27779 WP_003898981.1.27819 WP_003898981.1.27835 WP_003898981.1.27915 WP_003898981.1.27935 WP_003898981.1.27962 WP_003898981.1.28053 WP_003898981.1.28092 WP_003898981.1.28106 WP_003898981.1.28131 WP_003898981.1.28142 WP_003898981.1.28159 WP_003898981.1.2816 WP_003898981.1.28192 WP_003898981.1.28202 WP_003898981.1.28241 WP_003898981.1.28242 WP_003898981.1.28251 WP_003898981.1.28255 WP_003898981.1.28269 WP_003898981.1.28276 WP_003898981.1.28293 WP_003898981.1.28331 WP_003898981.1.28367 WP_003898981.1.28378 WP_003898981.1.28448 WP_003898981.1.2847 WP_003898981.1.28471 WP_003898981.1.28493 WP_003898981.1.28497 WP_003898981.1.28530 WP_003898981.1.28545 WP_003898981.1.28567 WP_003898981.1.28585 WP_003898981.1.286 WP_003898981.1.28610 WP_003898981.1.28617 WP_003898981.1.28634 WP_003898981.1.28642 WP_003898981.1.28671 WP_003898981.1.28698 WP_003898981.1.28703 WP_003898981.1.28739 WP_003898981.1.28781 WP_003898981.1.28787 WP_003898981.1.28827 WP_003898981.1.28839 WP_003898981.1.28847 WP_003898981.1.28850 WP_003898981.1.28851 WP_003898981.1.28865 WP_003898981.1.28897 WP_003898981.1.28914 WP_003898981.1.28935 WP_003898981.1.28936 WP_003898981.1.28939 WP_003898981.1.28952 WP_003898981.1.28975 WP_003898981.1.2899 WP_003898981.1.28993 WP_003898981.1.29000 WP_003898981.1.2901 WP_003898981.1.29028 WP_003898981.1.29033 WP_003898981.1.29058 WP_003898981.1.29115 WP_003898981.1.2916 WP_003898981.1.29217 WP_003898981.1.29234 WP_003898981.1.29264 WP_003898981.1.29275 WP_003898981.1.29306 WP_003898981.1.29339 WP_003898981.1.29348 WP_003898981.1.29364 WP_003898981.1.29367 WP_003898981.1.2938 WP_003898981.1.29426 WP_003898981.1.2944 WP_003898981.1.29449 WP_003898981.1.29450 WP_003898981.1.29452 WP_003898981.1.29510 WP_003898981.1.29515 WP_003898981.1.29525 WP_003898981.1.2953 WP_003898981.1.29587 WP_003898981.1.2959 WP_003898981.1.29592 WP_003898981.1.29599 WP_003898981.1.29611 WP_003898981.1.29632 WP_003898981.1.29649 WP_003898981.1.2965 WP_003898981.1.29659 WP_003898981.1.2969 WP_003898981.1.29696 WP_003898981.1.29718 WP_003898981.1.29745 WP_003898981.1.29747 WP_003898981.1.29769 WP_003898981.1.29825 WP_003898981.1.29830 WP_003898981.1.29847 WP_003898981.1.29861 WP_003898981.1.29869 WP_003898981.1.29883 WP_003898981.1.299 WP_003898981.1.29931 WP_003898981.1.29960 WP_003898981.1.30014 WP_003898981.1.3004 WP_003898981.1.30040 WP_003898981.1.30043 WP_003898981.1.30074 WP_003898981.1.30097 WP_003898981.1.30106 WP_003898981.1.30114 WP_003898981.1.30126 WP_003898981.1.30131 WP_003898981.1.30138 WP_003898981.1.30139 WP_003898981.1.30235 WP_003898981.1.30237 WP_003898981.1.3027 WP_003898981.1.30279 WP_003898981.1.30282 WP_003898981.1.30283 WP_003898981.1.30288 WP_003898981.1.30291 WP_003898981.1.30363 WP_003898981.1.30374 WP_003898981.1.30404 WP_003898981.1.30433 WP_003898981.1.30438 WP_003898981.1.30462 WP_003898981.1.30464 WP_003898981.1.30468 WP_003898981.1.30500 WP_003898981.1.3057 WP_003898981.1.30574 WP_003898981.1.30628 WP_003898981.1.30641 WP_003898981.1.30661 WP_003898981.1.30683 WP_003898981.1.30699 WP_003898981.1.30709 WP_003898981.1.30713 WP_003898981.1.30716 WP_003898981.1.30719 WP_003898981.1.30730 WP_003898981.1.30736 WP_003898981.1.30760 WP_003898981.1.30791 WP_003898981.1.308 WP_003898981.1.30807 WP_003898981.1.30818 WP_003898981.1.30848 WP_003898981.1.30877 WP_003898981.1.30888 WP_003898981.1.30901 WP_003898981.1.30903 WP_003898981.1.30912 WP_003898981.1.30913 WP_003898981.1.30914 WP_003898981.1.30919 WP_003898981.1.30977 WP_003898981.1.3100 WP_003898981.1.31002 WP_003898981.1.3101 WP_003898981.1.31034 WP_003898981.1.31047 WP_003898981.1.31070 WP_003898981.1.31074 WP_003898981.1.31102 WP_003898981.1.31127 WP_003898981.1.31184 WP_003898981.1.31199 WP_003898981.1.31226 WP_003898981.1.31230 WP_003898981.1.31233 WP_003898981.1.31263 WP_003898981.1.31264 WP_003898981.1.31270 WP_003898981.1.31287 WP_003898981.1.31290 WP_003898981.1.31304 WP_003898981.1.31346 WP_003898981.1.31348 WP_003898981.1.31354 WP_003898981.1.31390 WP_003898981.1.31414 WP_003898981.1.31417 WP_003898981.1.31428 WP_003898981.1.3143 WP_003898981.1.31458 WP_003898981.1.31483 WP_003898981.1.31498 WP_003898981.1.31507 WP_003898981.1.31537 WP_003898981.1.31548 WP_003898981.1.31569 WP_003898981.1.31573 WP_003898981.1.316 WP_003898981.1.31629 WP_003898981.1.31666 WP_003898981.1.31693 WP_003898981.1.31703 WP_003898981.1.31744 WP_003898981.1.31745 WP_003898981.1.31770 WP_003898981.1.31776 WP_003898981.1.31783 WP_003898981.1.318 WP_003898981.1.3184 WP_003898981.1.31840 WP_003898981.1.31880 WP_003898981.1.31911 WP_003898981.1.31930 WP_003898981.1.31932 WP_003898981.1.31955 WP_003898981.1.31985 WP_003898981.1.31991 WP_003898981.1.31995 WP_003898981.1.32004 WP_003898981.1.32039 WP_003898981.1.3204 WP_003898981.1.32045 WP_003898981.1.32071 WP_003898981.1.32098 WP_003898981.1.32132 WP_003898981.1.32157 WP_003898981.1.32164 WP_003898981.1.32179 WP_003898981.1.32198 WP_003898981.1.32297 WP_003898981.1.32317 WP_003898981.1.32383 WP_003898981.1.32400 WP_003898981.1.32403 WP_003898981.1.32416 WP_003898981.1.32433 WP_003898981.1.32461 WP_003898981.1.32482 WP_003898981.1.32503 WP_003898981.1.32556 WP_003898981.1.32562 WP_003898981.1.32592 WP_003898981.1.32620 WP_003898981.1.32647 WP_003898981.1.32653 WP_003898981.1.32654 WP_003898981.1.3268 WP_003898981.1.32695 WP_003898981.1.32706 WP_003898981.1.32716 WP_003898981.1.32738 WP_003898981.1.32752 WP_003898981.1.32780 WP_003898981.1.32781 WP_003898981.1.32793 WP_003898981.1.32799 WP_003898981.1.32833 WP_003898981.1.32862 WP_003898981.1.32880 WP_003898981.1.32909 WP_003898981.1.32935 WP_003898981.1.33007 WP_003898981.1.3302 WP_003898981.1.33028 WP_003898981.1.33044 WP_003898981.1.33054 WP_003898981.1.33082 WP_003898981.1.33141 WP_003898981.1.33148 WP_003898981.1.33155 WP_003898981.1.3321 WP_003898981.1.33215 WP_003898981.1.3327 WP_003898981.1.33278 WP_003898981.1.33288 WP_003898981.1.33305 WP_003898981.1.3331 WP_003898981.1.33319 WP_003898981.1.3333 WP_003898981.1.33393 WP_003898981.1.33403 WP_003898981.1.33452 WP_003898981.1.33467 WP_003898981.1.33477 WP_003898981.1.3349 WP_003898981.1.33519 WP_003898981.1.33542 WP_003898981.1.33601 WP_003898981.1.33602 WP_003898981.1.33633 WP_003898981.1.33646 WP_003898981.1.33673 WP_003898981.1.3369 WP_003898981.1.33705 WP_003898981.1.33762 WP_003898981.1.33783 WP_003898981.1.33789 WP_003898981.1.3383 WP_003898981.1.33832 WP_003898981.1.33839 WP_003898981.1.33848 WP_003898981.1.3387 WP_003898981.1.33886 WP_003898981.1.33895 WP_003898981.1.33912 WP_003898981.1.33954 WP_003898981.1.34042 WP_003898981.1.3405 WP_003898981.1.34055 WP_003898981.1.34056 WP_003898981.1.34065 WP_003898981.1.3408 WP_003898981.1.34090 WP_003898981.1.34109 WP_003898981.1.34152 WP_003898981.1.34163 WP_003898981.1.34181 WP_003898981.1.34197 WP_003898981.1.34198 WP_003898981.1.34215 WP_003898981.1.34219 WP_003898981.1.34255 WP_003898981.1.34260 WP_003898981.1.34275 WP_003898981.1.343 WP_003898981.1.34347 WP_003898981.1.34392 WP_003898981.1.344 WP_003898981.1.3443 WP_003898981.1.34435 WP_003898981.1.34446 WP_003898981.1.34499 WP_003898981.1.34505 WP_003898981.1.34516 WP_003898981.1.34529 WP_003898981.1.34551 WP_003898981.1.34563 WP_003898981.1.34576 WP_003898981.1.34581 WP_003898981.1.34588 WP_003898981.1.34596 WP_003898981.1.34599 WP_003898981.1.34639 WP_003898981.1.34724 WP_003898981.1.34755 WP_003898981.1.34777 WP_003898981.1.34841 WP_003898981.1.34908 WP_003898981.1.34919 WP_003898981.1.3492 WP_003898981.1.34933 WP_003898981.1.34945 WP_003898981.1.34946 WP_003898981.1.34954 WP_003898981.1.34960 WP_003898981.1.34963 WP_003898981.1.34965 WP_003898981.1.34968 WP_003898981.1.35023 WP_003898981.1.35069 WP_003898981.1.35072 WP_003898981.1.35078 WP_003898981.1.35156 WP_003898981.1.35160 WP_003898981.1.35162 WP_003898981.1.35176 WP_003898981.1.3520 WP_003898981.1.35213 WP_003898981.1.35221 WP_003898981.1.35246 WP_003898981.1.35278 WP_003898981.1.35301 WP_003898981.1.35311 WP_003898981.1.35312 WP_003898981.1.35317 WP_003898981.1.35319 WP_003898981.1.35347 WP_003898981.1.35363 WP_003898981.1.35382 WP_003898981.1.35385 WP_003898981.1.35396 WP_003898981.1.35397 WP_003898981.1.35439 WP_003898981.1.35455 WP_003898981.1.3548 WP_003898981.1.35484 WP_003898981.1.35492 WP_003898981.1.3553 WP_003898981.1.35553 WP_003898981.1.35555 WP_003898981.1.35561 WP_003898981.1.35610 WP_003898981.1.35635 WP_003898981.1.35657 WP_003898981.1.35687 WP_003898981.1.35689 WP_003898981.1.35707 WP_003898981.1.35732 WP_003898981.1.35754 WP_003898981.1.35767 WP_003898981.1.35770 WP_003898981.1.35771 WP_003898981.1.35780 WP_003898981.1.35805 WP_003898981.1.35821 WP_003898981.1.3584 WP_003898981.1.35848 WP_003898981.1.35864 WP_003898981.1.35874 WP_003898981.1.35876 WP_003898981.1.35899 WP_003898981.1.35954 WP_003898981.1.36005 WP_003898981.1.36014 WP_003898981.1.36023 WP_003898981.1.36051 WP_003898981.1.36053 WP_003898981.1.36075 WP_003898981.1.36089 WP_003898981.1.36098 WP_003898981.1.36116 WP_003898981.1.36145 WP_003898981.1.36205 WP_003898981.1.36228 WP_003898981.1.36252 WP_003898981.1.36260 WP_003898981.1.36271 WP_003898981.1.36303 WP_003898981.1.36309 WP_003898981.1.36315 WP_003898981.1.36319 WP_003898981.1.36321 WP_003898981.1.36326 WP_003898981.1.3634 WP_003898981.1.36356 WP_003898981.1.36357 WP_003898981.1.3636 WP_003898981.1.36385 WP_003898981.1.36399 WP_003898981.1.36436 WP_003898981.1.36465 WP_003898981.1.36469 WP_003898981.1.36473 WP_003898981.1.36485 WP_003898981.1.36508 WP_003898981.1.36540 WP_003898981.1.36561 WP_003898981.1.36571 WP_003898981.1.36573 WP_003898981.1.36578 WP_003898981.1.36585 WP_003898981.1.36597 WP_003898981.1.36614 WP_003898981.1.36674 WP_003898981.1.36720 WP_003898981.1.36727 WP_003898981.1.36733 WP_003898981.1.36785 WP_003898981.1.36810 WP_003898981.1.36862 WP_003898981.1.36893 WP_003898981.1.36901 WP_003898981.1.36921 WP_003898981.1.36935 WP_003898981.1.36941 WP_003898981.1.3695 WP_003898981.1.36968 WP_003898981.1.3700 WP_003898981.1.37004 WP_003898981.1.37012 WP_003898981.1.37088 WP_003898981.1.37131 WP_003898981.1.37157 WP_003898981.1.37175 WP_003898981.1.37188 WP_003898981.1.37213 WP_003898981.1.37229 WP_003898981.1.3724 WP_003898981.1.37277 WP_003898981.1.37305 WP_003898981.1.37330 WP_003898981.1.37389 WP_003898981.1.37400 WP_003898981.1.37440 WP_003898981.1.37459 WP_003898981.1.37468 WP_003898981.1.37475 WP_003898981.1.37484 WP_003898981.1.37601 WP_003898981.1.37612 WP_003898981.1.37632 WP_003898981.1.37643 WP_003898981.1.37655 WP_003898981.1.37660 WP_003898981.1.37674 WP_003898981.1.37700 WP_003898981.1.37701 WP_003898981.1.37709 WP_003898981.1.37711 WP_003898981.1.37721 WP_003898981.1.37722 WP_003898981.1.37747 WP_003898981.1.37765 WP_003898981.1.37772 WP_003898981.1.37804 WP_003898981.1.37809 WP_003898981.1.37859 WP_003898981.1.37877 WP_003898981.1.37913 WP_003898981.1.37950 WP_003898981.1.37973 WP_003898981.1.37975 WP_003898981.1.37983 WP_003898981.1.38 WP_003898981.1.38002 WP_003898981.1.3802 WP_003898981.1.38039 WP_003898981.1.38040 WP_003898981.1.38068 WP_003898981.1.38138 WP_003898981.1.38144 WP_003898981.1.38158 WP_003898981.1.38159 WP_003898981.1.38210 WP_003898981.1.38233 WP_003898981.1.38240 WP_003898981.1.38299 WP_003898981.1.38332 WP_003898981.1.38347 WP_003898981.1.38354 WP_003898981.1.38389 WP_003898981.1.38398 WP_003898981.1.38402 WP_003898981.1.38418 WP_003898981.1.38421 WP_003898981.1.38466 WP_003898981.1.38477 WP_003898981.1.38483 WP_003898981.1.3849 WP_003898981.1.385 WP_003898981.1.38530 WP_003898981.1.38594 WP_003898981.1.38611 WP_003898981.1.38638 WP_003898981.1.38639 WP_003898981.1.38648 WP_003898981.1.38654 WP_003898981.1.38660 WP_003898981.1.38671 WP_003898981.1.38672 WP_003898981.1.38677 WP_003898981.1.38750 WP_003898981.1.38772 WP_003898981.1.38812 WP_003898981.1.38821 WP_003898981.1.38844 WP_003898981.1.38863 WP_003898981.1.38873 WP_003898981.1.3889 WP_003898981.1.38894 WP_003898981.1.38909 WP_003898981.1.38939 WP_003898981.1.38974 WP_003898981.1.38975 WP_003898981.1.38991 WP_003898981.1.39025 WP_003898981.1.39070 WP_003898981.1.39072 WP_003898981.1.39095 WP_003898981.1.39106 WP_003898981.1.39165 WP_003898981.1.39174 WP_003898981.1.39176 WP_003898981.1.39178 WP_003898981.1.39190 WP_003898981.1.39201 WP_003898981.1.39207 WP_003898981.1.39236 WP_003898981.1.39239 WP_003898981.1.39252 WP_003898981.1.39288 WP_003898981.1.39295 WP_003898981.1.39306 WP_003898981.1.39359 WP_003898981.1.39364 WP_003898981.1.39447 WP_003898981.1.3945 WP_003898981.1.39455 WP_003898981.1.39521 WP_003898981.1.39560 WP_003898981.1.39592 WP_003898981.1.39593 WP_003898981.1.396 WP_003898981.1.3960 WP_003898981.1.39616 WP_003898981.1.39657 WP_003898981.1.39661 WP_003898981.1.39674 WP_003898981.1.39678 WP_003898981.1.3968 WP_003898981.1.39694 WP_003898981.1.3971 WP_003898981.1.39718 WP_003898981.1.39739 WP_003898981.1.39748 WP_003898981.1.39751 WP_003898981.1.39759 WP_003898981.1.39801 WP_003898981.1.39848 WP_003898981.1.39877 WP_003898981.1.39925 WP_003898981.1.3994 WP_003898981.1.39959 WP_003898981.1.3996 WP_003898981.1.39960 WP_003898981.1.3997 WP_003898981.1.39980 WP_003898981.1.40000 WP_003898981.1.40028 WP_003898981.1.4003 WP_003898981.1.40094 WP_003898981.1.40096 WP_003898981.1.40150 WP_003898981.1.40156 WP_003898981.1.40174 WP_003898981.1.40186 WP_003898981.1.40276 WP_003898981.1.40277 WP_003898981.1.40323 WP_003898981.1.40336 WP_003898981.1.40353 WP_003898981.1.4036 WP_003898981.1.40372 WP_003898981.1.40402 WP_003898981.1.40413 WP_003898981.1.40440 WP_003898981.1.40446 WP_003898981.1.40451 WP_003898981.1.40641 WP_003898981.1.40646 WP_003898981.1.40651 WP_003898981.1.40653 WP_003898981.1.4067 WP_003898981.1.40705 WP_003898981.1.40723 WP_003898981.1.40731 WP_003898981.1.40735 WP_003898981.1.40799 WP_003898981.1.40876 WP_003898981.1.40881 WP_003898981.1.40922 WP_003898981.1.4095 WP_003898981.1.40956 WP_003898981.1.40957 WP_003898981.1.40964 WP_003898981.1.4097 WP_003898981.1.410 WP_003898981.1.41000 WP_003898981.1.41055 WP_003898981.1.41108 WP_003898981.1.41123 WP_003898981.1.41177 WP_003898981.1.41202 WP_003898981.1.41219 WP_003898981.1.41231 WP_003898981.1.41249 WP_003898981.1.4127 WP_003898981.1.41355 WP_003898981.1.41376 WP_003898981.1.41430 WP_003898981.1.41447 WP_003898981.1.41469 WP_003898981.1.41504 WP_003898981.1.41553 WP_003898981.1.41564 WP_003898981.1.41632 WP_003898981.1.41635 WP_003898981.1.41636 WP_003898981.1.41648 WP_003898981.1.41660 WP_003898981.1.41685 WP_003898981.1.41695 WP_003898981.1.41704 WP_003898981.1.4171 WP_003898981.1.41719 WP_003898981.1.41733 WP_003898981.1.41744 WP_003898981.1.41774 WP_003898981.1.41791 WP_003898981.1.41803 WP_003898981.1.41820 WP_003898981.1.41828 WP_003898981.1.41829 WP_003898981.1.41860 WP_003898981.1.41912 WP_003898981.1.41921 WP_003898981.1.41933 WP_003898981.1.41944 WP_003898981.1.42043 WP_003898981.1.42078 WP_003898981.1.42094 WP_003898981.1.42112 WP_003898981.1.4212 WP_003898981.1.42122 WP_003898981.1.42134 WP_003898981.1.42188 WP_003898981.1.42202 WP_003898981.1.42208 WP_003898981.1.42247 WP_003898981.1.42255 WP_003898981.1.42273 WP_003898981.1.42278 WP_003898981.1.42304 WP_003898981.1.42309 WP_003898981.1.42370 WP_003898981.1.42385 WP_003898981.1.42400 WP_003898981.1.42409 WP_003898981.1.42414 WP_003898981.1.42461 WP_003898981.1.42465 WP_003898981.1.42467 WP_003898981.1.42473 WP_003898981.1.42474 WP_003898981.1.4248 WP_003898981.1.42494 WP_003898981.1.42519 WP_003898981.1.42524 WP_003898981.1.42534 WP_003898981.1.42562 WP_003898981.1.42568 WP_003898981.1.42570 WP_003898981.1.42618 WP_003898981.1.42660 WP_003898981.1.42695 WP_003898981.1.42704 WP_003898981.1.42705 WP_003898981.1.42722 WP_003898981.1.42777 WP_003898981.1.42835 WP_003898981.1.42839 WP_003898981.1.42842 WP_003898981.1.42905 WP_003898981.1.42916 WP_003898981.1.42930 WP_003898981.1.42971 WP_003898981.1.43005 WP_003898981.1.43009 WP_003898981.1.43053 WP_003898981.1.43082 WP_003898981.1.43087 WP_003898981.1.43098 WP_003898981.1.43236 WP_003898981.1.43246 WP_003898981.1.43255 WP_003898981.1.43266 WP_003898981.1.43269 WP_003898981.1.43273 WP_003898981.1.43296 WP_003898981.1.43306 WP_003898981.1.4335 WP_003898981.1.43368 WP_003898981.1.43395 WP_003898981.1.43462 WP_003898981.1.43475 WP_003898981.1.43478 WP_003898981.1.43484 WP_003898981.1.43557 WP_003898981.1.43578 WP_003898981.1.43588 WP_003898981.1.43643 WP_003898981.1.43664 WP_003898981.1.43684 WP_003898981.1.43686 WP_003898981.1.43706 WP_003898981.1.43716 WP_003898981.1.4377 WP_003898981.1.43781 WP_003898981.1.43794 WP_003898981.1.43815 WP_003898981.1.43846 WP_003898981.1.43861 WP_003898981.1.43863 WP_003898981.1.43866 WP_003898981.1.43872 WP_003898981.1.43885 WP_003898981.1.4390 WP_003898981.1.43902 WP_003898981.1.43921 WP_003898981.1.43936 WP_003898981.1.43937 WP_003898981.1.43960 WP_003898981.1.43965 WP_003898981.1.4399 WP_003898981.1.43993 WP_003898981.1.43996 WP_003898981.1.44 WP_003898981.1.44001 WP_003898981.1.44008 WP_003898981.1.44033 WP_003898981.1.44037 WP_003898981.1.44070 WP_003898981.1.44071 WP_003898981.1.44076 WP_003898981.1.44104 WP_003898981.1.44111 WP_003898981.1.44124 WP_003898981.1.44169 WP_003898981.1.44219 WP_003898981.1.44237 WP_003898981.1.44277 WP_003898981.1.44336 WP_003898981.1.44355 WP_003898981.1.44358 WP_003898981.1.4438 WP_003898981.1.44390 WP_003898981.1.44392 WP_003898981.1.4441 WP_003898981.1.44415 WP_003898981.1.44466 WP_003898981.1.44489 WP_003898981.1.44492 WP_003898981.1.44494 WP_003898981.1.44500 WP_003898981.1.44532 WP_003898981.1.44534 WP_003898981.1.44562 WP_003898981.1.44597 WP_003898981.1.44600 WP_003898981.1.44602 WP_003898981.1.44615 WP_003898981.1.4464 WP_003898981.1.44651 WP_003898981.1.44659 WP_003898981.1.44694 WP_003898981.1.44700 WP_003898981.1.44713 WP_003898981.1.44735 WP_003898981.1.44740 WP_003898981.1.44757 WP_003898981.1.4476 WP_003898981.1.44761 WP_003898981.1.44776 WP_003898981.1.44779 WP_003898981.1.44786 WP_003898981.1.44808 WP_003898981.1.44864 WP_003898981.1.44901 WP_003898981.1.44908 WP_003898981.1.44913 WP_003898981.1.4492 WP_003898981.1.44939 WP_003898981.1.44979 WP_003898981.1.44981 WP_003898981.1.45002 WP_003898981.1.45011 WP_003898981.1.4504 WP_003898981.1.45081 WP_003898981.1.45113 WP_003898981.1.45129 WP_003898981.1.45135 WP_003898981.1.45147 WP_003898981.1.45168 WP_003898981.1.4517 WP_003898981.1.45181 WP_003898981.1.45185 WP_003898981.1.45192 WP_003898981.1.45200 WP_003898981.1.45205 WP_003898981.1.45211 WP_003898981.1.45249 WP_003898981.1.45286 WP_003898981.1.45326 WP_003898981.1.45347 WP_003898981.1.45374 WP_003898981.1.45390 WP_003898981.1.454 WP_003898981.1.45407 WP_003898981.1.45451 WP_003898981.1.45453 WP_003898981.1.45460 WP_003898981.1.45470 WP_003898981.1.45474 WP_003898981.1.45491 WP_003898981.1.45510 WP_003898981.1.45563 WP_003898981.1.45584 WP_003898981.1.45590 WP_003898981.1.45619 WP_003898981.1.45626 WP_003898981.1.45631 WP_003898981.1.45666 WP_003898981.1.4571 WP_003898981.1.45743 WP_003898981.1.45765 WP_003898981.1.45776 WP_003898981.1.45805 WP_003898981.1.45815 WP_003898981.1.45849 WP_003898981.1.45867 WP_003898981.1.45923 WP_003898981.1.45926 WP_003898981.1.45963 WP_003898981.1.45992 WP_003898981.1.46025 WP_003898981.1.46083 WP_003898981.1.46090 WP_003898981.1.46092 WP_003898981.1.46100 WP_003898981.1.46101 WP_003898981.1.46103 WP_003898981.1.46107 WP_003898981.1.46127 WP_003898981.1.46128 WP_003898981.1.46129 WP_003898981.1.46150 WP_003898981.1.46201 WP_003898981.1.46226 WP_003898981.1.4624 WP_003898981.1.46253 WP_003898981.1.46268 WP_003898981.1.46285 WP_003898981.1.46300 WP_003898981.1.46313 WP_003898981.1.46336 WP_003898981.1.46365 WP_003898981.1.46370 WP_003898981.1.46381 WP_003898981.1.46411 WP_003898981.1.4644 WP_003898981.1.46442 WP_003898981.1.46453 WP_003898981.1.46478 WP_003898981.1.46492 WP_003898981.1.46521 WP_003898981.1.4653 WP_003898981.1.46532 WP_003898981.1.46539 WP_003898981.1.46568 WP_003898981.1.46585 WP_003898981.1.46609 WP_003898981.1.46625 WP_003898981.1.46642 WP_003898981.1.46647 WP_003898981.1.46724 WP_003898981.1.46758 WP_003898981.1.46773 WP_003898981.1.46777 WP_003898981.1.46786 WP_003898981.1.46792 WP_003898981.1.46847 WP_003898981.1.46851 WP_003898981.1.4687 WP_003898981.1.46936 WP_003898981.1.46980 WP_003898981.1.47011 WP_003898981.1.47066 WP_003898981.1.47077 WP_003898981.1.47083 WP_003898981.1.47106 WP_003898981.1.47142 WP_003898981.1.47166 WP_003898981.1.47178 WP_003898981.1.47179 WP_003898981.1.47194 WP_003898981.1.47207 WP_003898981.1.47210 WP_003898981.1.47261 WP_003898981.1.47262 WP_003898981.1.47402 WP_003898981.1.47423 WP_003898981.1.47467 WP_003898981.1.47502 WP_003898981.1.4751 WP_003898981.1.47511 WP_003898981.1.47537 WP_003898981.1.47540 WP_003898981.1.47568 WP_003898981.1.47572 WP_003898981.1.47636 WP_003898981.1.4764 WP_003898981.1.47653 WP_003898981.1.47679 WP_003898981.1.47681 WP_003898981.1.4771 WP_003898981.1.47717 WP_003898981.1.47743 WP_003898981.1.47754 WP_003898981.1.47773 WP_003898981.1.47776 WP_003898981.1.47780 WP_003898981.1.47805 WP_003898981.1.47832 WP_003898981.1.47847 WP_003898981.1.47858 WP_003898981.1.47861 WP_003898981.1.47893 WP_003898981.1.47899 WP_003898981.1.479 WP_003898981.1.47912 WP_003898981.1.47913 WP_003898981.1.47926 WP_003898981.1.4794 WP_003898981.1.47943 WP_003898981.1.47944 WP_003898981.1.47959 WP_003898981.1.47974 WP_003898981.1.47993 WP_003898981.1.48004 WP_003898981.1.48039 WP_003898981.1.48050 WP_003898981.1.48084 WP_003898981.1.48097 WP_003898981.1.48101 WP_003898981.1.4813 WP_003898981.1.48130 WP_003898981.1.48135 WP_003898981.1.48143 WP_003898981.1.48152 WP_003898981.1.48155 WP_003898981.1.48170 WP_003898981.1.48173 WP_003898981.1.48177 WP_003898981.1.48185 WP_003898981.1.48204 WP_003898981.1.48219 WP_003898981.1.4823 WP_003898981.1.48256 WP_003898981.1.48264 WP_003898981.1.48287 WP_003898981.1.48330 WP_003898981.1.48333 WP_003898981.1.48348 WP_003898981.1.48354 WP_003898981.1.48372 WP_003898981.1.48383 WP_003898981.1.48388 WP_003898981.1.48419 WP_003898981.1.48423 WP_003898981.1.48443 WP_003898981.1.48462 WP_003898981.1.48543 WP_003898981.1.48550 WP_003898981.1.48605 WP_003898981.1.48618 WP_003898981.1.4863 WP_003898981.1.48658 WP_003898981.1.48666 WP_003898981.1.48687 WP_003898981.1.48779 WP_003898981.1.4878 WP_003898981.1.48798 WP_003898981.1.48802 WP_003898981.1.48826 WP_003898981.1.48831 WP_003898981.1.48843 WP_003898981.1.4890 WP_003898981.1.48946 WP_003898981.1.48979 WP_003898981.1.49017 WP_003898981.1.49048 WP_003898981.1.49059 WP_003898981.1.4906 WP_003898981.1.4907 WP_003898981.1.49103 WP_003898981.1.49112 WP_003898981.1.4919 WP_003898981.1.49251 WP_003898981.1.49254 WP_003898981.1.49263 WP_003898981.1.49291 WP_003898981.1.49296 WP_003898981.1.49335 WP_003898981.1.49337 WP_003898981.1.49419 WP_003898981.1.49426 WP_003898981.1.49437 WP_003898981.1.49439 WP_003898981.1.49474 WP_003898981.1.49506 WP_003898981.1.49523 WP_003898981.1.49526 WP_003898981.1.49532 WP_003898981.1.4959 WP_003898981.1.49678 WP_003898981.1.49687 WP_003898981.1.49699 WP_003898981.1.49709 WP_003898981.1.4971 WP_003898981.1.4972 WP_003898981.1.49736 WP_003898981.1.49746 WP_003898981.1.49764 WP_003898981.1.49773 WP_003898981.1.49796 WP_003898981.1.49814 WP_003898981.1.49815 WP_003898981.1.49816 WP_003898981.1.49839 WP_003898981.1.49857 WP_003898981.1.49878 WP_003898981.1.49880 WP_003898981.1.49944 WP_003898981.1.4999 WP_003898981.1.49990 WP_003898981.1.50068 WP_003898981.1.50077 WP_003898981.1.5008 WP_003898981.1.50081 WP_003898981.1.50122 WP_003898981.1.50126 WP_003898981.1.50149 WP_003898981.1.50162 WP_003898981.1.5018 WP_003898981.1.50235 WP_003898981.1.50249 WP_003898981.1.50265 WP_003898981.1.50271 WP_003898981.1.50324 WP_003898981.1.50347 WP_003898981.1.50372 WP_003898981.1.50398 WP_003898981.1.50407 WP_003898981.1.50444 WP_003898981.1.50466 WP_003898981.1.50472 WP_003898981.1.5048 WP_003898981.1.50498 WP_003898981.1.5050 WP_003898981.1.50540 WP_003898981.1.50554 WP_003898981.1.50557 WP_003898981.1.50610 WP_003898981.1.50632 WP_003898981.1.50655 WP_003898981.1.50683 WP_003898981.1.50689 WP_003898981.1.50692 WP_003898981.1.50714 WP_003898981.1.50729 WP_003898981.1.50756 WP_003898981.1.50784 WP_003898981.1.50794 WP_003898981.1.50841 WP_003898981.1.50877 WP_003898981.1.5096 WP_003898981.1.50981 WP_003898981.1.50987 WP_003898981.1.51003 WP_003898981.1.51009 WP_003898981.1.51037 WP_003898981.1.51074 WP_003898981.1.51082 WP_003898981.1.51101 WP_003898981.1.51116 WP_003898981.1.51149 WP_003898981.1.51157 WP_003898981.1.51213 WP_003898981.1.51232 WP_003898981.1.51239 WP_003898981.1.51247 WP_003898981.1.51266 WP_003898981.1.51279 WP_003898981.1.51291 WP_003898981.1.51294 WP_003898981.1.51301 WP_003898981.1.51391 WP_003898981.1.51422 WP_003898981.1.51445 WP_003898981.1.51455 WP_003898981.1.51466 WP_003898981.1.51468 WP_003898981.1.51478 WP_003898981.1.51497 WP_003898981.1.51520 WP_003898981.1.51593 WP_003898981.1.51628 WP_003898981.1.5164 WP_003898981.1.51647 WP_003898981.1.51660 WP_003898981.1.51696 WP_003898981.1.51721 WP_003898981.1.51795 WP_003898981.1.51801 WP_003898981.1.51817 WP_003898981.1.51819 WP_003898981.1.51854 WP_003898981.1.51923 WP_003898981.1.51942 WP_003898981.1.51948 WP_003898981.1.51963 WP_003898981.1.51969 WP_003898981.1.52000 WP_003898981.1.52001 WP_003898981.1.52003 WP_003898981.1.52006 WP_003898981.1.52036 WP_003898981.1.52046 WP_003898981.1.52059 WP_003898981.1.52069 WP_003898981.1.52082 WP_003898981.1.52102 WP_003898981.1.52166 WP_003898981.1.52168 WP_003898981.1.52173 WP_003898981.1.52178 WP_003898981.1.52206 WP_003898981.1.52216 WP_003898981.1.52238 WP_003898981.1.52241 WP_003898981.1.52280 WP_003898981.1.52314 WP_003898981.1.52385 WP_003898981.1.52390 WP_003898981.1.524 WP_003898981.1.52485 WP_003898981.1.52486 WP_003898981.1.52504 WP_003898981.1.52522 WP_003898981.1.52531 WP_003898981.1.52533 WP_003898981.1.52545 WP_003898981.1.52553 WP_003898981.1.52563 WP_003898981.1.52564 WP_003898981.1.52574 WP_003898981.1.52641 WP_003898981.1.52673 WP_003898981.1.52674 WP_003898981.1.52713 WP_003898981.1.52761 WP_003898981.1.52778 WP_003898981.1.52797 WP_003898981.1.52818 WP_003898981.1.52872 WP_003898981.1.52873 WP_003898981.1.52891 WP_003898981.1.52892 WP_003898981.1.52909 WP_003898981.1.52970 WP_003898981.1.52998 WP_003898981.1.53053 WP_003898981.1.53056 WP_003898981.1.5306 WP_003898981.1.53088 WP_003898981.1.5309 WP_003898981.1.531 WP_003898981.1.53117 WP_003898981.1.53118 WP_003898981.1.53142 WP_003898981.1.53157 WP_003898981.1.53167 WP_003898981.1.53200 WP_003898981.1.53213 WP_003898981.1.53217 WP_003898981.1.53226 WP_003898981.1.53229 WP_003898981.1.53230 WP_003898981.1.53237 WP_003898981.1.53254 WP_003898981.1.53257 WP_003898981.1.5327 WP_003898981.1.53276 WP_003898981.1.53278 WP_003898981.1.533 WP_003898981.1.53306 WP_003898981.1.5334 WP_003898981.1.5335 WP_003898981.1.53353 WP_003898981.1.53381 WP_003898981.1.53413 WP_003898981.1.53458 WP_003898981.1.53460 WP_003898981.1.53480 WP_003898981.1.53517 WP_003898981.1.53522 WP_003898981.1.53525 WP_003898981.1.53526 WP_003898981.1.53553 WP_003898981.1.53606 WP_003898981.1.53628 WP_003898981.1.53643 WP_003898981.1.53667 WP_003898981.1.53679 WP_003898981.1.53715 WP_003898981.1.53730 WP_003898981.1.53742 WP_003898981.1.53743 WP_003898981.1.53754 WP_003898981.1.53787 WP_003898981.1.53803 WP_003898981.1.53818 WP_003898981.1.53853 WP_003898981.1.53865 WP_003898981.1.53888 WP_003898981.1.53900 WP_003898981.1.53912 WP_003898981.1.53914 WP_003898981.1.53952 WP_003898981.1.5398 WP_003898981.1.5408 WP_003898981.1.54089 WP_003898981.1.54093 WP_003898981.1.54099 WP_003898981.1.54112 WP_003898981.1.54141 WP_003898981.1.54162 WP_003898981.1.54179 WP_003898981.1.54218 WP_003898981.1.54225 WP_003898981.1.54227 WP_003898981.1.54232 WP_003898981.1.54241 WP_003898981.1.54245 WP_003898981.1.54247 WP_003898981.1.54260 WP_003898981.1.54275 WP_003898981.1.54280 WP_003898981.1.5429 WP_003898981.1.54294 WP_003898981.1.54314 WP_003898981.1.54351 WP_003898981.1.54370 WP_003898981.1.54428 WP_003898981.1.54449 WP_003898981.1.54494 WP_003898981.1.54514 WP_003898981.1.54519 WP_003898981.1.5452 WP_003898981.1.54531 WP_003898981.1.54537 WP_003898981.1.54553 WP_003898981.1.54555 WP_003898981.1.54575 WP_003898981.1.54686 WP_003898981.1.54687 WP_003898981.1.54705 WP_003898981.1.54730 WP_003898981.1.54732 WP_003898981.1.5475 WP_003898981.1.54797 WP_003898981.1.54807 WP_003898981.1.54836 WP_003898981.1.54838 WP_003898981.1.54860 WP_003898981.1.54888 WP_003898981.1.54909 WP_003898981.1.54939 WP_003898981.1.54944 WP_003898981.1.54945 WP_003898981.1.54953 WP_003898981.1.54964 WP_003898981.1.55015 WP_003898981.1.55022 WP_003898981.1.55023 WP_003898981.1.55051 WP_003898981.1.55072 WP_003898981.1.55088 WP_003898981.1.55106 WP_003898981.1.55126 WP_003898981.1.55128 WP_003898981.1.55140 WP_003898981.1.55150 WP_003898981.1.55210 WP_003898981.1.55227 WP_003898981.1.55248 WP_003898981.1.55257 WP_003898981.1.55258 WP_003898981.1.55267 WP_003898981.1.55279 WP_003898981.1.55307 WP_003898981.1.55326 WP_003898981.1.55328 WP_003898981.1.5533 WP_003898981.1.55345 WP_003898981.1.55396 WP_003898981.1.55398 WP_003898981.1.55441 WP_003898981.1.55459 WP_003898981.1.55501 WP_003898981.1.55578 WP_003898981.1.55626 WP_003898981.1.55641 WP_003898981.1.5569 WP_003898981.1.55723 WP_003898981.1.55735 WP_003898981.1.5574 WP_003898981.1.55772 WP_003898981.1.55802 WP_003898981.1.55819 WP_003898981.1.55821 WP_003898981.1.5583 WP_003898981.1.55849 WP_003898981.1.55856 WP_003898981.1.55860 WP_003898981.1.55882 WP_003898981.1.55883 WP_003898981.1.55894 WP_003898981.1.55902 WP_003898981.1.55908 WP_003898981.1.55909 WP_003898981.1.5591 WP_003898981.1.55961 WP_003898981.1.55977 WP_003898981.1.55983 WP_003898981.1.56028 WP_003898981.1.56057 WP_003898981.1.56060 WP_003898981.1.56107 WP_003898981.1.56132 WP_003898981.1.56163 WP_003898981.1.56167 WP_003898981.1.56178 WP_003898981.1.56287 WP_003898981.1.56292 WP_003898981.1.56327 WP_003898981.1.56359 WP_003898981.1.56365 WP_003898981.1.56394 WP_003898981.1.56443 WP_003898981.1.56473 WP_003898981.1.56478 WP_003898981.1.56500 WP_003898981.1.56517 WP_003898981.1.5656 WP_003898981.1.56577 WP_003898981.1.56593 WP_003898981.1.56625 WP_003898981.1.56637 WP_003898981.1.56670 WP_003898981.1.56697 WP_003898981.1.567 WP_003898981.1.56743 WP_003898981.1.56755 WP_003898981.1.56764 WP_003898981.1.56769 WP_003898981.1.56795 WP_003898981.1.5681 WP_003898981.1.56827 WP_003898981.1.56839 WP_003898981.1.56863 WP_003898981.1.56868 WP_003898981.1.56869 WP_003898981.1.56915 WP_003898981.1.56926 WP_003898981.1.56961 WP_003898981.1.56971 WP_003898981.1.56972 WP_003898981.1.57023 WP_003898981.1.57035 WP_003898981.1.57077 WP_003898981.1.57087 WP_003898981.1.57134 WP_003898981.1.57169 WP_003898981.1.57208 WP_003898981.1.57212 WP_003898981.1.57230 WP_003898981.1.5724 WP_003898981.1.5725 WP_003898981.1.5727 WP_003898981.1.57273 WP_003898981.1.573 WP_003898981.1.57326 WP_003898981.1.57328 WP_003898981.1.57331 WP_003898981.1.57340 WP_003898981.1.57351 WP_003898981.1.57380 WP_003898981.1.57430 WP_003898981.1.5744 WP_003898981.1.57440 WP_003898981.1.5745 WP_003898981.1.57461 WP_003898981.1.57469 WP_003898981.1.57489 WP_003898981.1.575 WP_003898981.1.57509 WP_003898981.1.57519 WP_003898981.1.57525 WP_003898981.1.57551 WP_003898981.1.57596 WP_003898981.1.57604 WP_003898981.1.57619 WP_003898981.1.57627 WP_003898981.1.57642 WP_003898981.1.57658 WP_003898981.1.57667 WP_003898981.1.57675 WP_003898981.1.57689 WP_003898981.1.57708 WP_003898981.1.57794 WP_003898981.1.57821 WP_003898981.1.57825 WP_003898981.1.57843 WP_003898981.1.57906 WP_003898981.1.57924 WP_003898981.1.57926 WP_003898981.1.57957 WP_003898981.1.57960 WP_003898981.1.57991 WP_003898981.1.58086 WP_003898981.1.58103 WP_003898981.1.58108 WP_003898981.1.5811 WP_003898981.1.58121 WP_003898981.1.58145 WP_003898981.1.58164 WP_003898981.1.58174 WP_003898981.1.582 WP_003898981.1.58209 WP_003898981.1.5824 WP_003898981.1.58250 WP_003898981.1.58259 WP_003898981.1.58283 WP_003898981.1.58288 WP_003898981.1.5830 WP_003898981.1.58303 WP_003898981.1.58311 WP_003898981.1.58330 WP_003898981.1.58359 WP_003898981.1.58386 WP_003898981.1.58393 WP_003898981.1.58431 WP_003898981.1.5844 WP_003898981.1.58457 WP_003898981.1.58488 WP_003898981.1.58518 WP_003898981.1.58534 WP_003898981.1.58559 WP_003898981.1.58567 WP_003898981.1.58573 WP_003898981.1.58602 WP_003898981.1.58612 WP_003898981.1.58619 WP_003898981.1.58630 WP_003898981.1.5865 WP_003898981.1.58671 WP_003898981.1.58690 WP_003898981.1.58702 WP_003898981.1.58743 WP_003898981.1.58754 WP_003898981.1.5879 WP_003898981.1.5881 WP_003898981.1.58824 WP_003898981.1.58848 WP_003898981.1.58857 WP_003898981.1.58891 WP_003898981.1.58892 WP_003898981.1.5890 WP_003898981.1.58904 WP_003898981.1.58921 WP_003898981.1.58930 WP_003898981.1.58953 WP_003898981.1.58961 WP_003898981.1.5898 WP_003898981.1.59025 WP_003898981.1.59029 WP_003898981.1.59037 WP_003898981.1.59044 WP_003898981.1.59088 WP_003898981.1.59112 WP_003898981.1.59130 WP_003898981.1.5914 WP_003898981.1.59147 WP_003898981.1.59166 WP_003898981.1.59205 WP_003898981.1.59209 WP_003898981.1.59237 WP_003898981.1.59240 WP_003898981.1.59253 WP_003898981.1.59254 WP_003898981.1.59262 WP_003898981.1.59270 WP_003898981.1.5928 WP_003898981.1.59304 WP_003898981.1.59305 WP_003898981.1.59309 WP_003898981.1.59326 WP_003898981.1.59328 WP_003898981.1.59333 WP_003898981.1.59338 WP_003898981.1.59428 WP_003898981.1.59487 WP_003898981.1.59537 WP_003898981.1.59561 WP_003898981.1.59722 WP_003898981.1.59727 WP_003898981.1.59732 WP_003898981.1.59738 WP_003898981.1.59750 WP_003898981.1.59757 WP_003898981.1.59808 WP_003898981.1.59850 WP_003898981.1.59860 WP_003898981.1.59861 WP_003898981.1.5987 WP_003898981.1.59878 WP_003898981.1.59888 WP_003898981.1.59952 WP_003898981.1.5996 WP_003898981.1.59961 WP_003898981.1.59974 WP_003898981.1.6000 WP_003898981.1.6003 WP_003898981.1.60047 WP_003898981.1.6007 WP_003898981.1.60121 WP_003898981.1.60125 WP_003898981.1.60135 WP_003898981.1.60139 WP_003898981.1.60152 WP_003898981.1.60171 WP_003898981.1.6020 WP_003898981.1.60205 WP_003898981.1.60207 WP_003898981.1.60215 WP_003898981.1.60217 WP_003898981.1.60267 WP_003898981.1.60288 WP_003898981.1.60291 WP_003898981.1.60301 WP_003898981.1.60305 WP_003898981.1.60312 WP_003898981.1.60313 WP_003898981.1.60314 WP_003898981.1.60367 WP_003898981.1.60376 WP_003898981.1.60403 WP_003898981.1.60421 WP_003898981.1.60451 WP_003898981.1.60460 WP_003898981.1.60487 WP_003898981.1.60512 WP_003898981.1.60583 WP_003898981.1.60632 WP_003898981.1.60657 WP_003898981.1.60687 WP_003898981.1.60689 WP_003898981.1.60727 WP_003898981.1.60738 WP_003898981.1.60763 WP_003898981.1.6077 WP_003898981.1.60791 WP_003898981.1.60834 WP_003898981.1.60878 WP_003898981.1.60879 WP_003898981.1.60913 WP_003898981.1.61000 WP_003898981.1.61001 WP_003898981.1.61012 WP_003898981.1.61014 WP_003898981.1.61015 WP_003898981.1.61037 WP_003898981.1.61052 WP_003898981.1.61065 WP_003898981.1.61100 WP_003898981.1.61101 WP_003898981.1.61138 WP_003898981.1.61142 WP_003898981.1.61198 WP_003898981.1.61234 WP_003898981.1.61281 WP_003898981.1.61314 WP_003898981.1.61321 WP_003898981.1.61326 WP_003898981.1.61328 WP_003898981.1.61368 WP_003898981.1.61391 WP_003898981.1.61406 WP_003898981.1.61409 WP_003898981.1.61420 WP_003898981.1.61422 WP_003898981.1.61425 WP_003898981.1.61428 WP_003898981.1.61469 WP_003898981.1.61522 WP_003898981.1.61557 WP_003898981.1.61567 WP_003898981.1.61571 WP_003898981.1.61573 WP_003898981.1.61584 WP_003898981.1.61586 WP_003898981.1.6159 WP_003898981.1.61592 WP_003898981.1.6160 WP_003898981.1.61614 WP_003898981.1.6163 WP_003898981.1.61655 WP_003898981.1.61665 WP_003898981.1.61682 WP_003898981.1.61692 WP_003898981.1.61719 WP_003898981.1.61728 WP_003898981.1.61750 WP_003898981.1.61754 WP_003898981.1.61755 WP_003898981.1.61757 WP_003898981.1.6179 WP_003898981.1.61816 WP_003898981.1.61842 WP_003898981.1.61850 WP_003898981.1.61862 WP_003898981.1.61865 WP_003898981.1.61868 WP_003898981.1.61911 WP_003898981.1.61941 WP_003898981.1.61953 WP_003898981.1.61986 WP_003898981.1.61987 WP_003898981.1.61998 WP_003898981.1.62021 WP_003898981.1.62087 WP_003898981.1.62089 WP_003898981.1.62101 WP_003898981.1.62104 WP_003898981.1.6211 WP_003898981.1.62132 WP_003898981.1.62162 WP_003898981.1.62225 WP_003898981.1.62230 WP_003898981.1.62238 WP_003898981.1.62249 WP_003898981.1.62270 WP_003898981.1.62281 WP_003898981.1.62307 WP_003898981.1.6231 WP_003898981.1.62359 WP_003898981.1.62371 WP_003898981.1.62379 WP_003898981.1.62395 WP_003898981.1.62449 WP_003898981.1.62468 WP_003898981.1.6248 WP_003898981.1.62508 WP_003898981.1.62565 WP_003898981.1.62594 WP_003898981.1.62616 WP_003898981.1.62666 WP_003898981.1.62687 WP_003898981.1.62715 WP_003898981.1.62730 WP_003898981.1.62738 WP_003898981.1.62761 WP_003898981.1.62766 WP_003898981.1.62839 WP_003898981.1.62841 WP_003898981.1.62909 WP_003898981.1.62936 WP_003898981.1.6294 WP_003898981.1.6295 WP_003898981.1.62962 WP_003898981.1.63007 WP_003898981.1.63019 WP_003898981.1.63032 WP_003898981.1.63037 WP_003898981.1.63064 WP_003898981.1.63066 WP_003898981.1.63072 WP_003898981.1.6308 WP_003898981.1.63081 WP_003898981.1.63096 WP_003898981.1.63106 WP_003898981.1.63144 WP_003898981.1.63160 WP_003898981.1.63175 WP_003898981.1.63194 WP_003898981.1.63222 WP_003898981.1.6328 WP_003898981.1.63291 WP_003898981.1.63312 WP_003898981.1.63317 WP_003898981.1.63373 WP_003898981.1.63384 WP_003898981.1.63403 WP_003898981.1.63424 WP_003898981.1.6345 WP_003898981.1.63464 WP_003898981.1.63483 WP_003898981.1.63502 WP_003898981.1.63504 WP_003898981.1.63522 WP_003898981.1.63530 WP_003898981.1.63564 WP_003898981.1.63567 WP_003898981.1.63596 WP_003898981.1.63600 WP_003898981.1.63623 WP_003898981.1.63624 WP_003898981.1.63625 WP_003898981.1.63627 WP_003898981.1.63654 WP_003898981.1.63662 WP_003898981.1.63734 WP_003898981.1.63807 WP_003898981.1.63819 WP_003898981.1.63844 WP_003898981.1.63888 WP_003898981.1.63915 WP_003898981.1.63918 WP_003898981.1.63961 WP_003898981.1.63970 WP_003898981.1.64000 WP_003898981.1.64027 WP_003898981.1.64058 WP_003898981.1.64065 WP_003898981.1.6407 WP_003898981.1.64082 WP_003898981.1.64091 WP_003898981.1.64102 WP_003898981.1.64104 WP_003898981.1.64169 WP_003898981.1.64219 WP_003898981.1.6422 WP_003898981.1.64222 WP_003898981.1.64228 WP_003898981.1.64235 WP_003898981.1.64249 WP_003898981.1.6427 WP_003898981.1.64278 WP_003898981.1.64287 WP_003898981.1.64414 WP_003898981.1.64419 WP_003898981.1.6443 WP_003898981.1.64463 WP_003898981.1.64480 WP_003898981.1.64497 WP_003898981.1.64506 WP_003898981.1.64511 WP_003898981.1.64513 WP_003898981.1.64515 WP_003898981.1.64522 WP_003898981.1.64526 WP_003898981.1.64543 WP_003898981.1.6456 WP_003898981.1.64567 WP_003898981.1.64588 WP_003898981.1.64589 WP_003898981.1.64594 WP_003898981.1.64595 WP_003898981.1.64608 WP_003898981.1.64619 WP_003898981.1.6464 WP_003898981.1.64664 WP_003898981.1.64669 WP_003898981.1.64672 WP_003898981.1.64680 WP_003898981.1.64682 WP_003898981.1.64727 WP_003898981.1.64729 WP_003898981.1.64774 WP_003898981.1.64776 WP_003898981.1.64832 WP_003898981.1.6486 WP_003898981.1.64870 WP_003898981.1.64898 WP_003898981.1.64924 WP_003898981.1.6493 WP_003898981.1.64941 WP_003898981.1.64973 WP_003898981.1.65001 WP_003898981.1.65026 WP_003898981.1.65053 WP_003898981.1.65070 WP_003898981.1.65079 WP_003898981.1.65102 WP_003898981.1.65157 WP_003898981.1.65181 WP_003898981.1.65212 WP_003898981.1.65229 WP_003898981.1.6523 WP_003898981.1.65289 WP_003898981.1.65291 WP_003898981.1.65315 WP_003898981.1.65329 WP_003898981.1.65359 WP_003898981.1.6536 WP_003898981.1.65374 WP_003898981.1.65386 WP_003898981.1.65416 WP_003898981.1.65433 WP_003898981.1.65455 WP_003898981.1.65467 WP_003898981.1.65488 WP_003898981.1.65529 WP_003898981.1.65539 WP_003898981.1.65583 WP_003898981.1.65612 WP_003898981.1.65623 WP_003898981.1.65635 WP_003898981.1.65637 WP_003898981.1.65648 WP_003898981.1.65683 WP_003898981.1.65686 WP_003898981.1.65688 WP_003898981.1.65707 WP_003898981.1.65733 WP_003898981.1.65746 WP_003898981.1.65747 WP_003898981.1.65759 WP_003898981.1.65816 WP_003898981.1.65830 WP_003898981.1.65858 WP_003898981.1.65862 WP_003898981.1.65869 WP_003898981.1.65893 WP_003898981.1.65929 WP_003898981.1.65932 WP_003898981.1.65958 WP_003898981.1.65974 WP_003898981.1.66004 WP_003898981.1.6606 WP_003898981.1.66089 WP_003898981.1.66149 WP_003898981.1.66151 WP_003898981.1.66276 WP_003898981.1.66293 WP_003898981.1.66297 WP_003898981.1.66323 WP_003898981.1.66325 WP_003898981.1.6633 WP_003898981.1.66355 WP_003898981.1.66367 WP_003898981.1.66394 WP_003898981.1.66396 WP_003898981.1.66451 WP_003898981.1.66455 WP_003898981.1.66457 WP_003898981.1.66464 WP_003898981.1.66466 WP_003898981.1.66487 WP_003898981.1.66504 WP_003898981.1.66544 WP_003898981.1.66558 WP_003898981.1.66580 WP_003898981.1.66612 WP_003898981.1.66617 WP_003898981.1.66635 WP_003898981.1.66656 WP_003898981.1.66663 WP_003898981.1.66675 WP_003898981.1.66715 WP_003898981.1.66718 WP_003898981.1.66762 WP_003898981.1.66776 WP_003898981.1.66808 WP_003898981.1.66817 WP_003898981.1.66819 WP_003898981.1.66826 WP_003898981.1.66830 WP_003898981.1.66842 WP_003898981.1.66868 WP_003898981.1.66878 WP_003898981.1.66880 WP_003898981.1.66893 WP_003898981.1.66961 WP_003898981.1.67005 WP_003898981.1.6704 WP_003898981.1.67061 WP_003898981.1.67098 WP_003898981.1.67146 WP_003898981.1.67197 WP_003898981.1.67198 WP_003898981.1.6720 WP_003898981.1.67207 WP_003898981.1.67218 WP_003898981.1.67220 WP_003898981.1.67225 WP_003898981.1.67231 WP_003898981.1.6724 WP_003898981.1.67257 WP_003898981.1.67298 WP_003898981.1.67307 WP_003898981.1.67324 WP_003898981.1.67332 WP_003898981.1.67360 WP_003898981.1.67396 WP_003898981.1.67417 WP_003898981.1.67422 WP_003898981.1.67459 WP_003898981.1.6746 WP_003898981.1.67473 WP_003898981.1.67482 WP_003898981.1.67496 WP_003898981.1.67499 WP_003898981.1.67523 WP_003898981.1.67536 WP_003898981.1.67575 WP_003898981.1.67587 WP_003898981.1.67598 WP_003898981.1.67600 WP_003898981.1.67602 WP_003898981.1.67679 WP_003898981.1.67692 WP_003898981.1.67744 WP_003898981.1.6775 WP_003898981.1.6777 WP_003898981.1.67809 WP_003898981.1.67816 WP_003898981.1.67844 WP_003898981.1.67848 WP_003898981.1.67870 WP_003898981.1.67888 WP_003898981.1.67915 WP_003898981.1.67945 WP_003898981.1.67949 WP_003898981.1.67980 WP_003898981.1.68022 WP_003898981.1.68029 WP_003898981.1.68037 WP_003898981.1.68038 WP_003898981.1.68045 WP_003898981.1.68057 WP_003898981.1.68083 WP_003898981.1.68088 WP_003898981.1.68106 WP_003898981.1.68110 WP_003898981.1.68169 WP_003898981.1.68193 WP_003898981.1.68212 WP_003898981.1.68227 WP_003898981.1.68243 WP_003898981.1.6825 WP_003898981.1.68297 WP_003898981.1.68309 WP_003898981.1.68325 WP_003898981.1.68329 WP_003898981.1.68340 WP_003898981.1.68384 WP_003898981.1.68388 WP_003898981.1.68429 WP_003898981.1.6843 WP_003898981.1.68444 WP_003898981.1.68465 WP_003898981.1.68518 WP_003898981.1.68569 WP_003898981.1.68576 WP_003898981.1.68580 WP_003898981.1.68586 WP_003898981.1.68623 WP_003898981.1.68637 WP_003898981.1.68646 WP_003898981.1.68667 WP_003898981.1.68669 WP_003898981.1.68672 WP_003898981.1.68684 WP_003898981.1.68704 WP_003898981.1.68708 WP_003898981.1.6872 WP_003898981.1.68734 WP_003898981.1.68748 WP_003898981.1.68754 WP_003898981.1.6876 WP_003898981.1.68761 WP_003898981.1.68763 WP_003898981.1.68766 WP_003898981.1.68774 WP_003898981.1.68796 WP_003898981.1.68824 WP_003898981.1.68832 WP_003898981.1.68833 WP_003898981.1.68841 WP_003898981.1.68859 WP_003898981.1.68876 WP_003898981.1.68906 WP_003898981.1.68916 WP_003898981.1.68923 WP_003898981.1.68945 WP_003898981.1.6896 WP_003898981.1.68981 WP_003898981.1.68984 WP_003898981.1.68997 WP_003898981.1.69076 WP_003898981.1.69079 WP_003898981.1.6908 WP_003898981.1.69082 WP_003898981.1.69178 WP_003898981.1.69208 WP_003898981.1.69231 WP_003898981.1.69256 WP_003898981.1.69311 WP_003898981.1.69322 WP_003898981.1.69342 WP_003898981.1.6936 WP_003898981.1.69369 WP_003898981.1.69398 WP_003898981.1.69401 WP_003898981.1.69426 WP_003898981.1.69427 WP_003898981.1.69429 WP_003898981.1.6949 WP_003898981.1.6951 WP_003898981.1.69511 WP_003898981.1.69526 WP_003898981.1.69528 WP_003898981.1.69547 WP_003898981.1.69573 WP_003898981.1.69581 WP_003898981.1.6960 WP_003898981.1.69617 WP_003898981.1.69634 WP_003898981.1.69647 WP_003898981.1.69659 WP_003898981.1.69673 WP_003898981.1.69682 WP_003898981.1.69684 WP_003898981.1.69686 WP_003898981.1.69707 WP_003898981.1.69709 WP_003898981.1.69723 WP_003898981.1.69736 WP_003898981.1.69778 WP_003898981.1.69800 WP_003898981.1.69802 WP_003898981.1.69845 WP_003898981.1.69870 WP_003898981.1.69873 WP_003898981.1.69898 WP_003898981.1.69913 WP_003898981.1.69931 WP_003898981.1.69938 WP_003898981.1.69955 WP_003898981.1.69957 WP_003898981.1.69981 WP_003898981.1.69990 WP_003898981.1.70000 WP_003898981.1.70017 WP_003898981.1.70032 WP_003898981.1.70055 WP_003898981.1.70062 WP_003898981.1.70072 WP_003898981.1.70131 WP_003898981.1.70132 WP_003898981.1.7022 WP_003898981.1.70227 WP_003898981.1.70255 WP_003898981.1.70274 WP_003898981.1.7029 WP_003898981.1.70325 WP_003898981.1.70328 WP_003898981.1.70364 WP_003898981.1.70368 WP_003898981.1.70369 WP_003898981.1.70418 WP_003898981.1.70422 WP_003898981.1.70435 WP_003898981.1.70444 WP_003898981.1.70463 WP_003898981.1.70471 WP_003898981.1.70480 WP_003898981.1.70498 WP_003898981.1.70525 WP_003898981.1.70573 WP_003898981.1.70577 WP_003898981.1.70610 WP_003898981.1.70615 WP_003898981.1.70618 WP_003898981.1.70622 WP_003898981.1.70626 WP_003898981.1.70668 WP_003898981.1.70699 WP_003898981.1.70704 WP_003898981.1.70729 WP_003898981.1.70757 WP_003898981.1.70782 WP_003898981.1.70796 WP_003898981.1.70830 WP_003898981.1.70834 WP_003898981.1.7084 WP_003898981.1.70840 WP_003898981.1.70864 WP_003898981.1.70871 WP_003898981.1.70915 WP_003898981.1.70958 WP_003898981.1.70964 WP_003898981.1.70976 WP_003898981.1.71015 WP_003898981.1.71063 WP_003898981.1.71076 WP_003898981.1.71083 WP_003898981.1.7111 WP_003898981.1.71118 WP_003898981.1.7113 WP_003898981.1.71187 WP_003898981.1.71191 WP_003898981.1.71255 WP_003898981.1.71258 WP_003898981.1.71259 WP_003898981.1.71289 WP_003898981.1.71326 WP_003898981.1.71329 WP_003898981.1.71331 WP_003898981.1.71344 WP_003898981.1.71390 WP_003898981.1.71414 WP_003898981.1.71440 WP_003898981.1.71457 WP_003898981.1.71464 WP_003898981.1.71490 WP_003898981.1.71492 WP_003898981.1.71509 WP_003898981.1.71517 WP_003898981.1.71527 WP_003898981.1.71532 WP_003898981.1.71545 WP_003898981.1.71546 WP_003898981.1.71604 WP_003898981.1.71630 WP_003898981.1.71638 WP_003898981.1.71654 WP_003898981.1.71664 WP_003898981.1.71665 WP_003898981.1.71683 WP_003898981.1.71701 WP_003898981.1.71718 WP_003898981.1.71731 WP_003898981.1.71778 WP_003898981.1.71781 WP_003898981.1.71803 WP_003898981.1.71847 WP_003898981.1.7185 WP_003898981.1.71851 WP_003898981.1.71871 WP_003898981.1.71909 WP_003898981.1.71957 WP_003898981.1.71970 WP_003898981.1.72047 WP_003898981.1.72061 WP_003898981.1.72062 WP_003898981.1.72072 WP_003898981.1.72111 WP_003898981.1.72122 WP_003898981.1.72143 WP_003898981.1.72168 WP_003898981.1.72179 WP_003898981.1.72209 WP_003898981.1.72227 WP_003898981.1.7224 WP_003898981.1.72268 WP_003898981.1.72332 WP_003898981.1.72380 WP_003898981.1.72401 WP_003898981.1.72405 WP_003898981.1.72420 WP_003898981.1.72441 WP_003898981.1.72451 WP_003898981.1.72457 WP_003898981.1.72459 WP_003898981.1.72460 WP_003898981.1.72466 WP_003898981.1.72487 WP_003898981.1.72506 WP_003898981.1.72543 WP_003898981.1.7256 WP_003898981.1.72576 WP_003898981.1.72578 WP_003898981.1.72585 WP_003898981.1.72591 WP_003898981.1.72592 WP_003898981.1.72640 WP_003898981.1.72661 WP_003898981.1.72739 WP_003898981.1.72744 WP_003898981.1.72755 WP_003898981.1.72784 WP_003898981.1.72792 WP_003898981.1.72826 WP_003898981.1.72831 WP_003898981.1.72852 WP_003898981.1.72853 WP_003898981.1.72879 WP_003898981.1.72880 WP_003898981.1.72938 WP_003898981.1.72954 WP_003898981.1.72957 WP_003898981.1.72959 WP_003898981.1.72982 WP_003898981.1.72988 WP_003898981.1.72993 WP_003898981.1.73006 WP_003898981.1.73013 WP_003898981.1.73025 WP_003898981.1.73028 WP_003898981.1.73042 WP_003898981.1.73045 WP_003898981.1.73092 WP_003898981.1.73118 WP_003898981.1.7312 WP_003898981.1.73127 WP_003898981.1.73154 WP_003898981.1.73163 WP_003898981.1.73182 WP_003898981.1.73205 WP_003898981.1.7321 WP_003898981.1.73310 WP_003898981.1.73391 WP_003898981.1.73404 WP_003898981.1.73424 WP_003898981.1.73436 WP_003898981.1.73445 WP_003898981.1.73465 WP_003898981.1.73466 WP_003898981.1.73470 WP_003898981.1.73471 WP_003898981.1.73478 WP_003898981.1.73482 WP_003898981.1.73507 WP_003898981.1.73532 WP_003898981.1.73550 WP_003898981.1.73564 WP_003898981.1.73623 WP_003898981.1.73629 WP_003898981.1.73644 WP_003898981.1.7366 WP_003898981.1.73661 WP_003898981.1.7368 WP_003898981.1.73688 WP_003898981.1.73723 WP_003898981.1.73744 WP_003898981.1.73750 WP_003898981.1.73760 WP_003898981.1.73774 WP_003898981.1.7379 WP_003898981.1.73813 WP_003898981.1.73840 WP_003898981.1.73876 WP_003898981.1.7389 WP_003898981.1.74016 WP_003898981.1.74039 WP_003898981.1.74083 WP_003898981.1.74129 WP_003898981.1.74144 WP_003898981.1.7417 WP_003898981.1.74190 WP_003898981.1.74210 WP_003898981.1.7423 WP_003898981.1.74259 WP_003898981.1.74262 WP_003898981.1.74269 WP_003898981.1.74282 WP_003898981.1.74291 WP_003898981.1.74296 WP_003898981.1.74304 WP_003898981.1.7432 WP_003898981.1.74347 WP_003898981.1.7436 WP_003898981.1.74378 WP_003898981.1.74382 WP_003898981.1.74395 WP_003898981.1.74400 WP_003898981.1.74432 WP_003898981.1.74442 WP_003898981.1.74499 WP_003898981.1.74504 WP_003898981.1.74511 WP_003898981.1.74523 WP_003898981.1.74525 WP_003898981.1.74555 WP_003898981.1.74628 WP_003898981.1.74641 WP_003898981.1.74653 WP_003898981.1.74660 WP_003898981.1.74683 WP_003898981.1.7469 WP_003898981.1.74725 WP_003898981.1.74760 WP_003898981.1.74809 WP_003898981.1.74820 WP_003898981.1.74870 WP_003898981.1.74881 WP_003898981.1.74888 WP_003898981.1.74952 WP_003898981.1.7496 WP_003898981.1.74988 WP_003898981.1.75043 WP_003898981.1.75055 WP_003898981.1.75078 WP_003898981.1.75081 WP_003898981.1.75120 WP_003898981.1.75163 WP_003898981.1.75188 WP_003898981.1.75200 WP_003898981.1.75234 WP_003898981.1.75239 WP_003898981.1.75263 WP_003898981.1.75342 WP_003898981.1.7535 WP_003898981.1.75376 WP_003898981.1.75391 WP_003898981.1.75395 WP_003898981.1.75441 WP_003898981.1.75510 WP_003898981.1.75581 WP_003898981.1.75598 WP_003898981.1.75635 WP_003898981.1.75665 WP_003898981.1.75671 WP_003898981.1.75741 WP_003898981.1.75749 WP_003898981.1.75772 WP_003898981.1.75774 WP_003898981.1.75833 WP_003898981.1.7585 WP_003898981.1.75864 WP_003898981.1.75868 WP_003898981.1.75878 WP_003898981.1.75927 WP_003898981.1.75946 WP_003898981.1.75968 WP_003898981.1.75974 WP_003898981.1.76016 WP_003898981.1.76032 WP_003898981.1.76037 WP_003898981.1.7604 WP_003898981.1.76045 WP_003898981.1.76052 WP_003898981.1.76058 WP_003898981.1.76110 WP_003898981.1.76133 WP_003898981.1.76138 WP_003898981.1.76157 WP_003898981.1.76172 WP_003898981.1.76177 WP_003898981.1.76183 WP_003898981.1.76209 WP_003898981.1.76281 WP_003898981.1.76291 WP_003898981.1.76297 WP_003898981.1.76360 WP_003898981.1.76379 WP_003898981.1.76403 WP_003898981.1.76414 WP_003898981.1.76427 WP_003898981.1.76436 WP_003898981.1.76442 WP_003898981.1.76456 WP_003898981.1.76533 WP_003898981.1.76616 WP_003898981.1.76625 WP_003898981.1.76629 WP_003898981.1.76635 WP_003898981.1.76638 WP_003898981.1.76640 WP_003898981.1.76644 WP_003898981.1.76677 WP_003898981.1.76678 WP_003898981.1.76679 WP_003898981.1.76734 WP_003898981.1.76744 WP_003898981.1.76757 WP_003898981.1.76781 WP_003898981.1.76818 WP_003898981.1.76824 WP_003898981.1.76835 WP_003898981.1.76873 WP_003898981.1.76888 WP_003898981.1.76900 WP_003898981.1.7691 WP_003898981.1.76947 WP_003898981.1.76954 WP_003898981.1.76955 WP_003898981.1.76963 WP_003898981.1.770 WP_003898981.1.77000 WP_003898981.1.77008 WP_003898981.1.77021 WP_003898981.1.77056 WP_003898981.1.77065 WP_003898981.1.77075 WP_003898981.1.77107 WP_003898981.1.77115 WP_003898981.1.77118 WP_003898981.1.77125 WP_003898981.1.77141 WP_003898981.1.77142 WP_003898981.1.77250 WP_003898981.1.77260 WP_003898981.1.77266 WP_003898981.1.77285 WP_003898981.1.77312 WP_003898981.1.77348 WP_003898981.1.77351 WP_003898981.1.77352 WP_003898981.1.77361 WP_003898981.1.774 WP_003898981.1.77404 WP_003898981.1.77425 WP_003898981.1.77463 WP_003898981.1.77474 WP_003898981.1.7748 WP_003898981.1.77484 WP_003898981.1.77491 WP_003898981.1.77499 WP_003898981.1.77510 WP_003898981.1.77554 WP_003898981.1.77559 WP_003898981.1.77599 WP_003898981.1.7762 WP_003898981.1.77627 WP_003898981.1.77649 WP_003898981.1.77654 WP_003898981.1.7766 WP_003898981.1.77667 WP_003898981.1.77704 WP_003898981.1.77706 WP_003898981.1.77774 WP_003898981.1.7778 WP_003898981.1.77790 WP_003898981.1.77809 WP_003898981.1.77820 WP_003898981.1.77843 WP_003898981.1.77855 WP_003898981.1.77865 WP_003898981.1.77868 WP_003898981.1.77890 WP_003898981.1.77909 WP_003898981.1.77911 WP_003898981.1.77931 WP_003898981.1.77984 WP_003898981.1.78020 WP_003898981.1.78024 WP_003898981.1.78075 WP_003898981.1.78086 WP_003898981.1.7809 WP_003898981.1.78098 WP_003898981.1.78105 WP_003898981.1.78113 WP_003898981.1.78136 WP_003898981.1.78162 WP_003898981.1.7817 WP_003898981.1.78200 WP_003898981.1.78216 WP_003898981.1.78236 WP_003898981.1.78238 WP_003898981.1.78322 WP_003898981.1.78338 WP_003898981.1.7836 WP_003898981.1.78360 WP_003898981.1.78386 WP_003898981.1.78435 WP_003898981.1.7844 WP_003898981.1.78459 WP_003898981.1.78488 WP_003898981.1.7849 WP_003898981.1.78499 WP_003898981.1.785 WP_003898981.1.78516 WP_003898981.1.78524 WP_003898981.1.78526 WP_003898981.1.78538 WP_003898981.1.78545 WP_003898981.1.78547 WP_003898981.1.78574 WP_003898981.1.78580 WP_003898981.1.78648 WP_003898981.1.78649 WP_003898981.1.78655 WP_003898981.1.78657 WP_003898981.1.78659 WP_003898981.1.7869 WP_003898981.1.78692 WP_003898981.1.78760 WP_003898981.1.78766 WP_003898981.1.78776 WP_003898981.1.78778 WP_003898981.1.78784 WP_003898981.1.78788 WP_003898981.1.78790 WP_003898981.1.78860 WP_003898981.1.7887 WP_003898981.1.78884 WP_003898981.1.78932 WP_003898981.1.78977 WP_003898981.1.78980 WP_003898981.1.79016 WP_003898981.1.79033 WP_003898981.1.79064 WP_003898981.1.79066 WP_003898981.1.79068 WP_003898981.1.79095 WP_003898981.1.79112 WP_003898981.1.79122 WP_003898981.1.79145 WP_003898981.1.79152 WP_003898981.1.79163 WP_003898981.1.79182 WP_003898981.1.79213 WP_003898981.1.79218 WP_003898981.1.79278 WP_003898981.1.79290 WP_003898981.1.79319 WP_003898981.1.79325 WP_003898981.1.79326 WP_003898981.1.79330 WP_003898981.1.79339 WP_003898981.1.79394 WP_003898981.1.79399 WP_003898981.1.79413 WP_003898981.1.79422 WP_003898981.1.79445 WP_003898981.1.79447 WP_003898981.1.79455 WP_003898981.1.79480 WP_003898981.1.79482 WP_003898981.1.79488 WP_003898981.1.79500 WP_003898981.1.79502 WP_003898981.1.79508 WP_003898981.1.79561 WP_003898981.1.79565 WP_003898981.1.79578 WP_003898981.1.79588 WP_003898981.1.79598 WP_003898981.1.79615 WP_003898981.1.79684 WP_003898981.1.79698 WP_003898981.1.797 WP_003898981.1.79744 WP_003898981.1.79784 WP_003898981.1.79806 WP_003898981.1.79819 WP_003898981.1.79826 WP_003898981.1.79828 WP_003898981.1.79853 WP_003898981.1.79863 WP_003898981.1.79881 WP_003898981.1.79885 WP_003898981.1.79898 WP_003898981.1.7990 WP_003898981.1.79900 WP_003898981.1.79913 WP_003898981.1.79918 WP_003898981.1.79947 WP_003898981.1.79948 WP_003898981.1.7995 WP_003898981.1.7997 WP_003898981.1.80004 WP_003898981.1.80022 WP_003898981.1.80030 WP_003898981.1.80054 WP_003898981.1.80084 WP_003898981.1.80129 WP_003898981.1.80177 WP_003898981.1.80234 WP_003898981.1.8026 WP_003898981.1.80275 WP_003898981.1.8029 WP_003898981.1.80299 WP_003898981.1.80304 WP_003898981.1.8037 WP_003898981.1.80370 WP_003898981.1.80387 WP_003898981.1.8044 WP_003898981.1.80451 WP_003898981.1.80458 WP_003898981.1.80461 WP_003898981.1.80490 WP_003898981.1.80503 WP_003898981.1.80507 WP_003898981.1.80552 WP_003898981.1.80576 WP_003898981.1.80588 WP_003898981.1.80599 WP_003898981.1.8060 WP_003898981.1.80624 WP_003898981.1.80636 WP_003898981.1.80673 WP_003898981.1.80711 WP_003898981.1.80714 WP_003898981.1.80743 WP_003898981.1.80784 WP_003898981.1.80815 WP_003898981.1.80853 WP_003898981.1.80918 WP_003898981.1.8093 WP_003898981.1.80967 WP_003898981.1.8097 WP_003898981.1.80988 WP_003898981.1.81007 WP_003898981.1.81013 WP_003898981.1.8105 WP_003898981.1.81059 WP_003898981.1.81063 WP_003898981.1.81066 WP_003898981.1.81075 WP_003898981.1.81091 WP_003898981.1.81119 WP_003898981.1.81125 WP_003898981.1.81136 WP_003898981.1.8114 WP_003898981.1.81189 WP_003898981.1.81192 WP_003898981.1.812 WP_003898981.1.81230 WP_003898981.1.81249 WP_003898981.1.81250 WP_003898981.1.81264 WP_003898981.1.8128 WP_003898981.1.81287 WP_003898981.1.81297 WP_003898981.1.8138 WP_003898981.1.81407 WP_003898981.1.81439 WP_003898981.1.81465 WP_003898981.1.81529 WP_003898981.1.81538 WP_003898981.1.81541 WP_003898981.1.81560 WP_003898981.1.81561 WP_003898981.1.81567 WP_003898981.1.81583 WP_003898981.1.81686 WP_003898981.1.81712 WP_003898981.1.81720 WP_003898981.1.81731 WP_003898981.1.81774 WP_003898981.1.81788 WP_003898981.1.81820 WP_003898981.1.81850 WP_003898981.1.81883 WP_003898981.1.81891 WP_003898981.1.81911 WP_003898981.1.81918 WP_003898981.1.82011 WP_003898981.1.82048 WP_003898981.1.82069 WP_003898981.1.82071 WP_003898981.1.82136 WP_003898981.1.82142 WP_003898981.1.8215 WP_003898981.1.82158 WP_003898981.1.82209 WP_003898981.1.82210 WP_003898981.1.82228 WP_003898981.1.82236 WP_003898981.1.82251 WP_003898981.1.82271 WP_003898981.1.82305 WP_003898981.1.82307 WP_003898981.1.82317 WP_003898981.1.8232 WP_003898981.1.82346 WP_003898981.1.82374 WP_003898981.1.82385 WP_003898981.1.82429 WP_003898981.1.82460 WP_003898981.1.82483 WP_003898981.1.82531 WP_003898981.1.82546 WP_003898981.1.82549 WP_003898981.1.82577 WP_003898981.1.82592 WP_003898981.1.82597 WP_003898981.1.82598 WP_003898981.1.82625 WP_003898981.1.82642 WP_003898981.1.82651 WP_003898981.1.82653 WP_003898981.1.82681 WP_003898981.1.82685 WP_003898981.1.8271 WP_003898981.1.82712 WP_003898981.1.8273 WP_003898981.1.82743 WP_003898981.1.82757 WP_003898981.1.82774 WP_003898981.1.82803 WP_003898981.1.82860 WP_003898981.1.82871 WP_003898981.1.82892 WP_003898981.1.82935 WP_003898981.1.82957 WP_003898981.1.82981 WP_003898981.1.82983 WP_003898981.1.83004 WP_003898981.1.83009 WP_003898981.1.83044 WP_003898981.1.83074 WP_003898981.1.83146 WP_003898981.1.83149 WP_003898981.1.83159 WP_003898981.1.8317 WP_003898981.1.83173 WP_003898981.1.83181 WP_003898981.1.83182 WP_003898981.1.83191 WP_003898981.1.83197 WP_003898981.1.83212 WP_003898981.1.8326 WP_003898981.1.83262 WP_003898981.1.83273 WP_003898981.1.83309 WP_003898981.1.83332 WP_003898981.1.83334 WP_003898981.1.83341 WP_003898981.1.83349 WP_003898981.1.8335 WP_003898981.1.83353 WP_003898981.1.83367 WP_003898981.1.83380 WP_003898981.1.83381 WP_003898981.1.83389 WP_003898981.1.83408 WP_003898981.1.83409 WP_003898981.1.83435 WP_003898981.1.83470 WP_003898981.1.83524 WP_003898981.1.83526 WP_003898981.1.8358 WP_003898981.1.83589 WP_003898981.1.83601 WP_003898981.1.83611 WP_003898981.1.83638 WP_003898981.1.83656 WP_003898981.1.83667 WP_003898981.1.83689 WP_003898981.1.83692 WP_003898981.1.83705 WP_003898981.1.83766 WP_003898981.1.83793 WP_003898981.1.83794 WP_003898981.1.83802 WP_003898981.1.83805 WP_003898981.1.83839 WP_003898981.1.83842 WP_003898981.1.83850 WP_003898981.1.83884 WP_003898981.1.83920 WP_003898981.1.83929 WP_003898981.1.83930 WP_003898981.1.83975 WP_003898981.1.83991 WP_003898981.1.8400 WP_003898981.1.84027 WP_003898981.1.8404 WP_003898981.1.84057 WP_003898981.1.84070 WP_003898981.1.8409 WP_003898981.1.84112 WP_003898981.1.84146 WP_003898981.1.8415 WP_003898981.1.84176 WP_003898981.1.84192 WP_003898981.1.84228 WP_003898981.1.8424 WP_003898981.1.84244 WP_003898981.1.84259 WP_003898981.1.8426 WP_003898981.1.84277 WP_003898981.1.84287 WP_003898981.1.8434 WP_003898981.1.84409 WP_003898981.1.84438 WP_003898981.1.84460 WP_003898981.1.84488 WP_003898981.1.84504 WP_003898981.1.84525 WP_003898981.1.84620 WP_003898981.1.84623 WP_003898981.1.84641 WP_003898981.1.84655 WP_003898981.1.84666 WP_003898981.1.84670 WP_003898981.1.84739 WP_003898981.1.84748 WP_003898981.1.84766 WP_003898981.1.84772 WP_003898981.1.84774 WP_003898981.1.848 WP_003898981.1.84812 WP_003898981.1.84836 WP_003898981.1.84839 WP_003898981.1.84846 WP_003898981.1.84873 WP_003898981.1.84938 WP_003898981.1.84968 WP_003898981.1.84973 WP_003898981.1.84981 WP_003898981.1.8503 WP_003898981.1.85038 WP_003898981.1.85043 WP_003898981.1.8505 WP_003898981.1.85074 WP_003898981.1.8509 WP_003898981.1.8512 WP_003898981.1.85148 WP_003898981.1.8518 WP_003898981.1.8522 WP_003898981.1.85242 WP_003898981.1.85276 WP_003898981.1.85281 WP_003898981.1.85284 WP_003898981.1.85314 WP_003898981.1.85319 WP_003898981.1.85330 WP_003898981.1.85341 WP_003898981.1.8535 WP_003898981.1.85363 WP_003898981.1.85371 WP_003898981.1.85377 WP_003898981.1.85387 WP_003898981.1.85458 WP_003898981.1.8546 WP_003898981.1.85478 WP_003898981.1.85480 WP_003898981.1.85488 WP_003898981.1.85495 WP_003898981.1.85551 WP_003898981.1.85557 WP_003898981.1.85577 WP_003898981.1.85599 WP_003898981.1.85610 WP_003898981.1.8563 WP_003898981.1.85648 WP_003898981.1.85679 WP_003898981.1.85704 WP_003898981.1.85717 WP_003898981.1.85727 WP_003898981.1.85737 WP_003898981.1.85763 WP_003898981.1.85808 WP_003898981.1.85819 WP_003898981.1.85820 WP_003898981.1.85823 WP_003898981.1.85832 WP_003898981.1.8586 WP_003898981.1.85872 WP_003898981.1.85894 WP_003898981.1.85909 WP_003898981.1.85913 WP_003898981.1.85953 WP_003898981.1.85986 WP_003898981.1.86000 WP_003898981.1.86025 WP_003898981.1.86032 WP_003898981.1.86048 WP_003898981.1.86052 WP_003898981.1.86067 WP_003898981.1.86103 WP_003898981.1.86122 WP_003898981.1.86124 WP_003898981.1.86160 WP_003898981.1.86164 WP_003898981.1.86168 WP_003898981.1.86190 WP_003898981.1.86204 WP_003898981.1.86208 WP_003898981.1.86235 WP_003898981.1.86249 WP_003898981.1.86260 WP_003898981.1.86290 WP_003898981.1.863 WP_003898981.1.86327 WP_003898981.1.86334 WP_003898981.1.86337 WP_003898981.1.86368 WP_003898981.1.86377 WP_003898981.1.86425 WP_003898981.1.86459 WP_003898981.1.8649 WP_003898981.1.86499 WP_003898981.1.86520 WP_003898981.1.86561 WP_003898981.1.86568 WP_003898981.1.86575 WP_003898981.1.86584 WP_003898981.1.86605 WP_003898981.1.86626 WP_003898981.1.86648 WP_003898981.1.86684 WP_003898981.1.86696 WP_003898981.1.86705 WP_003898981.1.86718 WP_003898981.1.86725 WP_003898981.1.86757 WP_003898981.1.86766 WP_003898981.1.86814 WP_003898981.1.86820 WP_003898981.1.86825 WP_003898981.1.86834 WP_003898981.1.8685 WP_003898981.1.86851 WP_003898981.1.86855 WP_003898981.1.86867 WP_003898981.1.86883 WP_003898981.1.8689 WP_003898981.1.86892 WP_003898981.1.86933 WP_003898981.1.86941 WP_003898981.1.86950 WP_003898981.1.86962 WP_003898981.1.86963 WP_003898981.1.8700 WP_003898981.1.87002 WP_003898981.1.87031 WP_003898981.1.87116 WP_003898981.1.87117 WP_003898981.1.87178 WP_003898981.1.87191 WP_003898981.1.87201 WP_003898981.1.87209 WP_003898981.1.87240 WP_003898981.1.87266 WP_003898981.1.87273 WP_003898981.1.87275 WP_003898981.1.8733 WP_003898981.1.87345 WP_003898981.1.8737 WP_003898981.1.87401 WP_003898981.1.87409 WP_003898981.1.87444 WP_003898981.1.87446 WP_003898981.1.87459 WP_003898981.1.87472 WP_003898981.1.87489 WP_003898981.1.87494 WP_003898981.1.87496 WP_003898981.1.87582 WP_003898981.1.87588 WP_003898981.1.87617 WP_003898981.1.87619 WP_003898981.1.87620 WP_003898981.1.87634 WP_003898981.1.87643 WP_003898981.1.8765 WP_003898981.1.87650 WP_003898981.1.87654 WP_003898981.1.87658 WP_003898981.1.87665 WP_003898981.1.87676 WP_003898981.1.87677 WP_003898981.1.87692 WP_003898981.1.87732 WP_003898981.1.87784 WP_003898981.1.87796 WP_003898981.1.87809 WP_003898981.1.87817 WP_003898981.1.87827 WP_003898981.1.87831 WP_003898981.1.87837 WP_003898981.1.87866 WP_003898981.1.8789 WP_003898981.1.87911 WP_003898981.1.87924 WP_003898981.1.87951 WP_003898981.1.87956 WP_003898981.1.87991 WP_003898981.1.88 WP_003898981.1.88002 WP_003898981.1.88037 WP_003898981.1.88039 WP_003898981.1.88072 WP_003898981.1.88077 WP_003898981.1.88121 WP_003898981.1.88191 WP_003898981.1.88205 WP_003898981.1.88217 WP_003898981.1.88219 WP_003898981.1.88245 WP_003898981.1.88253 WP_003898981.1.88294 WP_003898981.1.88315 WP_003898981.1.88316 WP_003898981.1.88320 WP_003898981.1.88338 WP_003898981.1.8840 WP_003898981.1.88437 WP_003898981.1.88453 WP_003898981.1.88469 WP_003898981.1.88489 WP_003898981.1.88507 WP_003898981.1.88530 WP_003898981.1.88537 WP_003898981.1.88541 WP_003898981.1.88592 WP_003898981.1.88616 WP_003898981.1.88618 WP_003898981.1.8862 WP_003898981.1.88625 WP_003898981.1.88632 WP_003898981.1.88634 WP_003898981.1.88649 WP_003898981.1.8870 WP_003898981.1.88737 WP_003898981.1.888 WP_003898981.1.88824 WP_003898981.1.88886 WP_003898981.1.88965 WP_003898981.1.88985 WP_003898981.1.8902 WP_003898981.1.89025 WP_003898981.1.89041 WP_003898981.1.89046 WP_003898981.1.89082 WP_003898981.1.89162 WP_003898981.1.89168 WP_003898981.1.8917 WP_003898981.1.89205 WP_003898981.1.89207 WP_003898981.1.89225 WP_003898981.1.8925 WP_003898981.1.89277 WP_003898981.1.89286 WP_003898981.1.89293 WP_003898981.1.89320 WP_003898981.1.8935 WP_003898981.1.89371 WP_003898981.1.89378 WP_003898981.1.89392 WP_003898981.1.89406 WP_003898981.1.89451 WP_003898981.1.89453 WP_003898981.1.89473 WP_003898981.1.89475 WP_003898981.1.89483 WP_003898981.1.895 WP_003898981.1.89513 WP_003898981.1.89517 WP_003898981.1.89522 WP_003898981.1.8954 WP_003898981.1.89543 WP_003898981.1.8957 WP_003898981.1.89572 WP_003898981.1.89589 WP_003898981.1.89607 WP_003898981.1.89613 WP_003898981.1.89625 WP_003898981.1.89648 WP_003898981.1.8967 WP_003898981.1.89670 WP_003898981.1.89676 WP_003898981.1.89729 WP_003898981.1.89739 WP_003898981.1.89762 WP_003898981.1.8977 WP_003898981.1.89808 WP_003898981.1.89829 WP_003898981.1.89831 WP_003898981.1.89844 WP_003898981.1.89849 WP_003898981.1.8989 WP_003898981.1.89901 WP_003898981.1.89903 WP_003898981.1.89909 WP_003898981.1.89922 WP_003898981.1.89926 WP_003898981.1.89963 WP_003898981.1.89971 WP_003898981.1.8998 WP_003898981.1.89987 WP_003898981.1.900 WP_003898981.1.90048 WP_003898981.1.90080 WP_003898981.1.90130 WP_003898981.1.90134 WP_003898981.1.90157 WP_003898981.1.90184 WP_003898981.1.90199 WP_003898981.1.90231 WP_003898981.1.90245 WP_003898981.1.90308 WP_003898981.1.90322 WP_003898981.1.90328 WP_003898981.1.90372 WP_003898981.1.90481 WP_003898981.1.90499 WP_003898981.1.9050 WP_003898981.1.90527 WP_003898981.1.90550 WP_003898981.1.90560 WP_003898981.1.90612 WP_003898981.1.90640 WP_003898981.1.90672 WP_003898981.1.90691 WP_003898981.1.90711 WP_003898981.1.90722 WP_003898981.1.90744 WP_003898981.1.9075 WP_003898981.1.90767 WP_003898981.1.90771 WP_003898981.1.90788 WP_003898981.1.90800 WP_003898981.1.90810 WP_003898981.1.90816 WP_003898981.1.90819 WP_003898981.1.9082 WP_003898981.1.90831 WP_003898981.1.90884 WP_003898981.1.90899 WP_003898981.1.90906 WP_003898981.1.90958 WP_003898981.1.90976 WP_003898981.1.90977 WP_003898981.1.91026 WP_003898981.1.91032 WP_003898981.1.91053 WP_003898981.1.91082 WP_003898981.1.91106 WP_003898981.1.91112 WP_003898981.1.91144 WP_003898981.1.91151 WP_003898981.1.91157 WP_003898981.1.91167 WP_003898981.1.91169 WP_003898981.1.91192 WP_003898981.1.91201 WP_003898981.1.91207 WP_003898981.1.91208 WP_003898981.1.91211 WP_003898981.1.91230 WP_003898981.1.91244 WP_003898981.1.91251 WP_003898981.1.91260 WP_003898981.1.91284 WP_003898981.1.91294 WP_003898981.1.91303 WP_003898981.1.91322 WP_003898981.1.91386 WP_003898981.1.9139 WP_003898981.1.91398 WP_003898981.1.91430 WP_003898981.1.91436 WP_003898981.1.91483 WP_003898981.1.91496 WP_003898981.1.91576 WP_003898981.1.91589 WP_003898981.1.91694 WP_003898981.1.91695 WP_003898981.1.91716 WP_003898981.1.91717 WP_003898981.1.91728 WP_003898981.1.91743 WP_003898981.1.91759 WP_003898981.1.91784 WP_003898981.1.91785 WP_003898981.1.91786 WP_003898981.1.91802 WP_003898981.1.91822 WP_003898981.1.91828 WP_003898981.1.9189 WP_003898981.1.91896 WP_003898981.1.9190 WP_003898981.1.91915 WP_003898981.1.91931 WP_003898981.1.91937 WP_003898981.1.91944 WP_003898981.1.91953 WP_003898981.1.91957 WP_003898981.1.91976 WP_003898981.1.92083 WP_003898981.1.92127 WP_003898981.1.92144 WP_003898981.1.92150 WP_003898981.1.92153 WP_003898981.1.92190 WP_003898981.1.92192 WP_003898981.1.92200 WP_003898981.1.92220 WP_003898981.1.92221 WP_003898981.1.92222 WP_003898981.1.92273 WP_003898981.1.92289 WP_003898981.1.9229 WP_003898981.1.92294 WP_003898981.1.92300 WP_003898981.1.92317 WP_003898981.1.92334 WP_003898981.1.92338 WP_003898981.1.92345 WP_003898981.1.92356 WP_003898981.1.92364 WP_003898981.1.92380 WP_003898981.1.92428 WP_003898981.1.92447 WP_003898981.1.92456 WP_003898981.1.92467 WP_003898981.1.92471 WP_003898981.1.92490 WP_003898981.1.92508 WP_003898981.1.92511 WP_003898981.1.92523 WP_003898981.1.92527 WP_003898981.1.92536 WP_003898981.1.92592 WP_003898981.1.92603 WP_003898981.1.92606 WP_003898981.1.92610 WP_003898981.1.92613 WP_003898981.1.9263 WP_003898981.1.9265 WP_003898981.1.92650 WP_003898981.1.92677 WP_003898981.1.92685 WP_003898981.1.92689 WP_003898981.1.92690 WP_003898981.1.92714 WP_003898981.1.92736 WP_003898981.1.9274 WP_003898981.1.92752 WP_003898981.1.92760 WP_003898981.1.92777 WP_003898981.1.92803 WP_003898981.1.92833 WP_003898981.1.92856 WP_003898981.1.92881 WP_003898981.1.92892 WP_003898981.1.92907 WP_003898981.1.92908 WP_003898981.1.9291 WP_003898981.1.92917 WP_003898981.1.92996 WP_003898981.1.93006 WP_003898981.1.93009 WP_003898981.1.93015 WP_003898981.1.93043 WP_003898981.1.9307 WP_003898981.1.93083 WP_003898981.1.93097 WP_003898981.1.93137 WP_003898981.1.93192 WP_003898981.1.93199 WP_003898981.1.93203 WP_003898981.1.93212 WP_003898981.1.93234 WP_003898981.1.93245 WP_003898981.1.93257 WP_003898981.1.93265 WP_003898981.1.93297 WP_003898981.1.93320 WP_003898981.1.93328 WP_003898981.1.93337 WP_003898981.1.93343 WP_003898981.1.93349 WP_003898981.1.93363 WP_003898981.1.93377 WP_003898981.1.9338 WP_003898981.1.93407 WP_003898981.1.93417 WP_003898981.1.93419 WP_003898981.1.93426 WP_003898981.1.9344 WP_003898981.1.93443 WP_003898981.1.93447 WP_003898981.1.93470 WP_003898981.1.93483 WP_003898981.1.93487 WP_003898981.1.93495 WP_003898981.1.93499 WP_003898981.1.93516 WP_003898981.1.93536 WP_003898981.1.93544 WP_003898981.1.93555 WP_003898981.1.93560 WP_003898981.1.93564 WP_003898981.1.9357 WP_003898981.1.93573 WP_003898981.1.93576 WP_003898981.1.93588 WP_003898981.1.9363 WP_003898981.1.93645 WP_003898981.1.93649 WP_003898981.1.93659 WP_003898981.1.93677 WP_003898981.1.9368 WP_003898981.1.93689 WP_003898981.1.93693 WP_003898981.1.93698 WP_003898981.1.93706 WP_003898981.1.9371 WP_003898981.1.93792 WP_003898981.1.93823 WP_003898981.1.93871 WP_003898981.1.9388 WP_003898981.1.93894 WP_003898981.1.93903 WP_003898981.1.93907 WP_003898981.1.93913 WP_003898981.1.93946 WP_003898981.1.93950 WP_003898981.1.93953 WP_003898981.1.93954 WP_003898981.1.93988 WP_003898981.1.9407 WP_003898981.1.94143 WP_003898981.1.94154 WP_003898981.1.94204 WP_003898981.1.94205 WP_003898981.1.94226 WP_003898981.1.94231 WP_003898981.1.94256 WP_003898981.1.94261 WP_003898981.1.94281 WP_003898981.1.94292 WP_003898981.1.9431 WP_003898981.1.94326 WP_003898981.1.94339 WP_003898981.1.94392 WP_003898981.1.94416 WP_003898981.1.94421 WP_003898981.1.94456 WP_003898981.1.94480 WP_003898981.1.94495 WP_003898981.1.94511 WP_003898981.1.94512 WP_003898981.1.94528 WP_003898981.1.94564 WP_003898981.1.946 WP_003898981.1.94623 WP_003898981.1.94629 WP_003898981.1.9465 WP_003898981.1.94673 WP_003898981.1.94714 WP_003898981.1.94730 WP_003898981.1.94736 WP_003898981.1.94776 WP_003898981.1.9478 WP_003898981.1.94834 WP_003898981.1.94852 WP_003898981.1.94872 WP_003898981.1.9488 WP_003898981.1.94902 WP_003898981.1.94916 WP_003898981.1.94979 WP_003898981.1.94994 WP_003898981.1.94996 WP_003898981.1.94998 WP_003898981.1.95007 WP_003898981.1.95010 WP_003898981.1.95015 WP_003898981.1.95034 WP_003898981.1.95068 WP_003898981.1.95081 WP_003898981.1.95082 WP_003898981.1.9509 WP_003898981.1.95096 WP_003898981.1.95112 WP_003898981.1.95138 WP_003898981.1.9514 WP_003898981.1.95179 WP_003898981.1.95188 WP_003898981.1.95190 WP_003898981.1.95234 WP_003898981.1.95241 WP_003898981.1.95257 WP_003898981.1.95279 WP_003898981.1.9531 WP_003898981.1.95335 WP_003898981.1.95344 WP_003898981.1.9535 WP_003898981.1.95370 WP_003898981.1.95392 WP_003898981.1.95416 WP_003898981.1.95417 WP_003898981.1.95454 WP_003898981.1.95455 WP_003898981.1.95491 WP_003898981.1.95497 WP_003898981.1.95508 WP_003898981.1.95509 WP_003898981.1.95529 WP_003898981.1.95556 WP_003898981.1.95557 WP_003898981.1.95565 WP_003898981.1.95578 WP_003898981.1.95580 WP_003898981.1.95585 WP_003898981.1.95643 WP_003898981.1.95679 WP_003898981.1.95685 WP_003898981.1.957 WP_003898981.1.95724 WP_003898981.1.95727 WP_003898981.1.95730 WP_003898981.1.95758 WP_003898981.1.95797 WP_003898981.1.95839 WP_003898981.1.9585 WP_003898981.1.9590 WP_003898981.1.95902 WP_003898981.1.95924 WP_003898981.1.95926 WP_003898981.1.95953 WP_003898981.1.95958 WP_003898981.1.95964 WP_003898981.1.95973 WP_003898981.1.96006 WP_003898981.1.9602 WP_003898981.1.96036 WP_003898981.1.96062 WP_003898981.1.96065 WP_003898981.1.96098 WP_003898981.1.96146 WP_003898981.1.96171 WP_003898981.1.96182 WP_003898981.1.96230 WP_003898981.1.96242 WP_003898981.1.96245 WP_003898981.1.96254 WP_003898981.1.96259 WP_003898981.1.96286 WP_003898981.1.96313 WP_003898981.1.96345 WP_003898981.1.96360 WP_003898981.1.96373 WP_003898981.1.96486 WP_003898981.1.96569 WP_003898981.1.96573 WP_003898981.1.96576 WP_003898981.1.96611 WP_003898981.1.96621 WP_003898981.1.9667 WP_003898981.1.96681 WP_003898981.1.96726 WP_003898981.1.96754 WP_003898981.1.9678 WP_003898981.1.9685 WP_003898981.1.97008 WP_003898981.1.97009 WP_003898981.1.97056 WP_003898981.1.97084 WP_003898981.1.97087 WP_003898981.1.97094 WP_003898981.1.97096 WP_003898981.1.97108 WP_003898981.1.97113 WP_003898981.1.97122 WP_003898981.1.97129 WP_003898981.1.97136 WP_003898981.1.9716 WP_003898981.1.97176 WP_003898981.1.97222 WP_003898981.1.97237 WP_003898981.1.97242 WP_003898981.1.97270 WP_003898981.1.97283 WP_003898981.1.97296 WP_003898981.1.97321 WP_003898981.1.97325 WP_003898981.1.97366 WP_003898981.1.97376 WP_003898981.1.97380 WP_003898981.1.97462 WP_003898981.1.97517 WP_003898981.1.97519 WP_003898981.1.97535 WP_003898981.1.97540 WP_003898981.1.97545 WP_003898981.1.97546 WP_003898981.1.97550 WP_003898981.1.97577 WP_003898981.1.97584 WP_003898981.1.9759 WP_003898981.1.97591 WP_003898981.1.97609 WP_003898981.1.97618 WP_003898981.1.9763 WP_003898981.1.97669 WP_003898981.1.97673 WP_003898981.1.97700 WP_003898981.1.97701 WP_003898981.1.9773 WP_003898981.1.97730 WP_003898981.1.97740 WP_003898981.1.97751 WP_003898981.1.97754 WP_003898981.1.97797 WP_003898981.1.9782 WP_003898981.1.9784 WP_003898981.1.97888 WP_003898981.1.9790 WP_003898981.1.9795 WP_003898981.1.97951 WP_003898981.1.97958 WP_003898981.1.97966 WP_003898981.1.97977 WP_003898981.1.97979 WP_003898981.1.97995 WP_003898981.1.98034 WP_003898981.1.98052 WP_003898981.1.98072 WP_003898981.1.98114 WP_003898981.1.98128 WP_003898981.1.98188 WP_003898981.1.98189 WP_003898981.1.98225 WP_003898981.1.98291 WP_003898981.1.98335 WP_003898981.1.98350 WP_003898981.1.98395 WP_003898981.1.98412 WP_003898981.1.98441 WP_003898981.1.98443 WP_003898981.1.98462 WP_003898981.1.9848 WP_003898981.1.98482 WP_003898981.1.98486 WP_003898981.1.98488 WP_003898981.1.98503 WP_003898981.1.98516 WP_003898981.1.98536 WP_003898981.1.98541 WP_003898981.1.98566 WP_003898981.1.98576 WP_003898981.1.98590 WP_003898981.1.98594 WP_003898981.1.98599 WP_003898981.1.98629 WP_003898981.1.98646 WP_003898981.1.98649 WP_003898981.1.98656 WP_003898981.1.9867 WP_003898981.1.98697 WP_003898981.1.98701 WP_003898981.1.98739 WP_003898981.1.98749 WP_003898981.1.98765 WP_003898981.1.98770 WP_003898981.1.98777 WP_003898981.1.98778 WP_003898981.1.98802 WP_003898981.1.98838 WP_003898981.1.98906 WP_003898981.1.98948 WP_003898981.1.98953 WP_003898981.1.98984 WP_003898981.1.99000 WP_003898981.1.99023 WP_003898981.1.99030 WP_003898981.1.99055 WP_003898981.1.99086 WP_003898981.1.99115 WP_003898981.1.99176 WP_003898981.1.99211 WP_003898981.1.99216 WP_003898981.1.99222 WP_003898981.1.99251 WP_003898981.1.99294 WP_003898981.1.99312 WP_003898981.1.99315 WP_003898981.1.99316 WP_003898981.1.99322 WP_003898981.1.99328 WP_003898981.1.99365 WP_003898981.1.99368 WP_003898981.1.99396 WP_003898981.1.99402 WP_003898981.1.99419 WP_003898981.1.99438 WP_003898981.1.99460 WP_003898981.1.99468 WP_003898981.1.99473 WP_003898981.1.99513 WP_003898981.1.99529 WP_003898981.1.99548 WP_003898981.1.99572 WP_003898981.1.99575 WP_003898981.1.99578 WP_003898981.1.99605 WP_003898981.1.99609 WP_003898981.1.99617 WP_003898981.1.99635 WP_003898981.1.99650 WP_003898981.1.99672 WP_003898981.1.99701 WP_003898981.1.99711 WP_003898981.1.99716 WP_003898981.1.99740 WP_003898981.1.99745 WP_003898981.1.99749 WP_003898981.1.9976 WP_003898981.1.99798 WP_003898981.1.99817 WP_003898981.1.99847 WP_003898981.1.99852 WP_003898981.1.99886 WP_003898981.1.99897 WP_003898981.1.99899 WP_003898981.1.99915 WP_003898981.1.99991 gi|15841167|ref|NP_336204.1| gi|494696084|ref|YP_007961587.1| 336982.TBFG_11722 419947.MRA_1717 478434.TBMG_02288 83331.MT1748 83332.Rv1707 gi|479314617|ref|YP_007854669.1| gi|15608845|ref|NP_216223.1| gi|392432712|ref|YP_006473756.1| gi|506926186|ref|YP_008006636.1| gi|148822913|ref|YP_001287667.1| gi|375296501|ref|YP_005100768.1| gi|392386380|ref|YP_005308009.1| gi|197740363|ref|YP_002161677.1| GO.8843 Rv1707 gi|383307538|ref|YP_005360349.1| gi|148661505|ref|YP_001283028.1| gi|471337634|ref|YP_007610347.1| gi|15608845|ref|NP_216223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]