SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 336982.TBFG_13718 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  336982.TBFG_13718
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 336982.TBFG_13718
Sequence length 122
Comment (Mycobacterium tuberculosis F11)
Sequence
MSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALVIDLSAVEFLG
SVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRI
DR
Download sequence
Identical sequences A0A045KE59 A0A0H3LFE7 A0A109SSN2 A0A120J3E3 A0A197J0T8 A0A1S1B5M1 A5U911 F8M913 G0TK93 I6YGX6 M8D0Z8 P9WGE0 P9WGE1 R4MJY4
gi|15610823|ref|NP_218204.1| gi|339633679|ref|YP_004725321.1| gi|15843305|ref|NP_338342.1| NP_218204.1.84033 WP_003419762.1.100000 WP_003419762.1.100021 WP_003419762.1.100069 WP_003419762.1.100087 WP_003419762.1.10015 WP_003419762.1.100208 WP_003419762.1.100216 WP_003419762.1.10022 WP_003419762.1.100255 WP_003419762.1.100260 WP_003419762.1.100270 WP_003419762.1.100279 WP_003419762.1.100286 WP_003419762.1.100308 WP_003419762.1.100309 WP_003419762.1.100318 WP_003419762.1.100337 WP_003419762.1.100338 WP_003419762.1.10037 WP_003419762.1.100383 WP_003419762.1.100395 WP_003419762.1.100396 WP_003419762.1.1004 WP_003419762.1.100401 WP_003419762.1.100459 WP_003419762.1.100460 WP_003419762.1.100552 WP_003419762.1.100581 WP_003419762.1.100600 WP_003419762.1.100625 WP_003419762.1.10064 WP_003419762.1.100666 WP_003419762.1.100671 WP_003419762.1.100677 WP_003419762.1.100682 WP_003419762.1.100697 WP_003419762.1.100703 WP_003419762.1.100716 WP_003419762.1.100722 WP_003419762.1.100754 WP_003419762.1.100757 WP_003419762.1.1008 WP_003419762.1.100812 WP_003419762.1.100845 WP_003419762.1.100866 WP_003419762.1.10088 WP_003419762.1.100889 WP_003419762.1.10090 WP_003419762.1.100910 WP_003419762.1.100915 WP_003419762.1.100918 WP_003419762.1.100935 WP_003419762.1.100984 WP_003419762.1.100992 WP_003419762.1.100998 WP_003419762.1.101 WP_003419762.1.101025 WP_003419762.1.101028 WP_003419762.1.10104 WP_003419762.1.101048 WP_003419762.1.101054 WP_003419762.1.101075 WP_003419762.1.101143 WP_003419762.1.10116 WP_003419762.1.10117 WP_003419762.1.101209 WP_003419762.1.10125 WP_003419762.1.101290 WP_003419762.1.101323 WP_003419762.1.101350 WP_003419762.1.101367 WP_003419762.1.101398 WP_003419762.1.101403 WP_003419762.1.101421 WP_003419762.1.10144 WP_003419762.1.101442 WP_003419762.1.10145 WP_003419762.1.101452 WP_003419762.1.101456 WP_003419762.1.101481 WP_003419762.1.101493 WP_003419762.1.101496 WP_003419762.1.101525 WP_003419762.1.101533 WP_003419762.1.101535 WP_003419762.1.101553 WP_003419762.1.101558 WP_003419762.1.10156 WP_003419762.1.101573 WP_003419762.1.101576 WP_003419762.1.10159 WP_003419762.1.101592 WP_003419762.1.101604 WP_003419762.1.101607 WP_003419762.1.101622 WP_003419762.1.101644 WP_003419762.1.101659 WP_003419762.1.101671 WP_003419762.1.101687 WP_003419762.1.101698 WP_003419762.1.10170 WP_003419762.1.101713 WP_003419762.1.101722 WP_003419762.1.101733 WP_003419762.1.101743 WP_003419762.1.101753 WP_003419762.1.101754 WP_003419762.1.101764 WP_003419762.1.101773 WP_003419762.1.101795 WP_003419762.1.101797 WP_003419762.1.101798 WP_003419762.1.101802 WP_003419762.1.101826 WP_003419762.1.101836 WP_003419762.1.101858 WP_003419762.1.101859 WP_003419762.1.101862 WP_003419762.1.101888 WP_003419762.1.101894 WP_003419762.1.101899 WP_003419762.1.1019 WP_003419762.1.101923 WP_003419762.1.101925 WP_003419762.1.10193 WP_003419762.1.102 WP_003419762.1.102008 WP_003419762.1.102017 WP_003419762.1.102053 WP_003419762.1.102055 WP_003419762.1.102063 WP_003419762.1.102099 WP_003419762.1.1021 WP_003419762.1.10211 WP_003419762.1.102119 WP_003419762.1.102121 WP_003419762.1.102143 WP_003419762.1.10216 WP_003419762.1.10224 WP_003419762.1.10253 WP_003419762.1.10262 WP_003419762.1.10272 WP_003419762.1.10277 WP_003419762.1.1033 WP_003419762.1.10362 WP_003419762.1.10366 WP_003419762.1.10396 WP_003419762.1.10410 WP_003419762.1.10414 WP_003419762.1.10421 WP_003419762.1.10430 WP_003419762.1.1044 WP_003419762.1.10440 WP_003419762.1.10445 WP_003419762.1.10471 WP_003419762.1.10472 WP_003419762.1.10489 WP_003419762.1.105 WP_003419762.1.10518 WP_003419762.1.10523 WP_003419762.1.10545 WP_003419762.1.1057 WP_003419762.1.10594 WP_003419762.1.10603 WP_003419762.1.10606 WP_003419762.1.10615 WP_003419762.1.10623 WP_003419762.1.10635 WP_003419762.1.10643 WP_003419762.1.10648 WP_003419762.1.10662 WP_003419762.1.10709 WP_003419762.1.10735 WP_003419762.1.10740 WP_003419762.1.10756 WP_003419762.1.1078 WP_003419762.1.10791 WP_003419762.1.10799 WP_003419762.1.10825 WP_003419762.1.10848 WP_003419762.1.10863 WP_003419762.1.10879 WP_003419762.1.10912 WP_003419762.1.10916 WP_003419762.1.10923 WP_003419762.1.10927 WP_003419762.1.1095 WP_003419762.1.10956 WP_003419762.1.10958 WP_003419762.1.10962 WP_003419762.1.10980 WP_003419762.1.10981 WP_003419762.1.10993 WP_003419762.1.1100 WP_003419762.1.11040 WP_003419762.1.11061 WP_003419762.1.11070 WP_003419762.1.11141 WP_003419762.1.11171 WP_003419762.1.11175 WP_003419762.1.11176 WP_003419762.1.11222 WP_003419762.1.11236 WP_003419762.1.11329 WP_003419762.1.1133 WP_003419762.1.11342 WP_003419762.1.11373 WP_003419762.1.11376 WP_003419762.1.11390 WP_003419762.1.11402 WP_003419762.1.11481 WP_003419762.1.11487 WP_003419762.1.11489 WP_003419762.1.11491 WP_003419762.1.11514 WP_003419762.1.11589 WP_003419762.1.11596 WP_003419762.1.11604 WP_003419762.1.11610 WP_003419762.1.11697 WP_003419762.1.11707 WP_003419762.1.11752 WP_003419762.1.11758 WP_003419762.1.11761 WP_003419762.1.11775 WP_003419762.1.11804 WP_003419762.1.11822 WP_003419762.1.11826 WP_003419762.1.11856 WP_003419762.1.11898 WP_003419762.1.11906 WP_003419762.1.11939 WP_003419762.1.11960 WP_003419762.1.11961 WP_003419762.1.11972 WP_003419762.1.11984 WP_003419762.1.120 WP_003419762.1.12001 WP_003419762.1.12049 WP_003419762.1.12052 WP_003419762.1.12100 WP_003419762.1.12116 WP_003419762.1.12130 WP_003419762.1.12133 WP_003419762.1.12161 WP_003419762.1.12165 WP_003419762.1.12184 WP_003419762.1.12190 WP_003419762.1.12216 WP_003419762.1.12265 WP_003419762.1.12275 WP_003419762.1.12293 WP_003419762.1.12294 WP_003419762.1.123 WP_003419762.1.1231 WP_003419762.1.12314 WP_003419762.1.12327 WP_003419762.1.12338 WP_003419762.1.1236 WP_003419762.1.12371 WP_003419762.1.12372 WP_003419762.1.12389 WP_003419762.1.12406 WP_003419762.1.1241 WP_003419762.1.12421 WP_003419762.1.12424 WP_003419762.1.12446 WP_003419762.1.12464 WP_003419762.1.12479 WP_003419762.1.12519 WP_003419762.1.12523 WP_003419762.1.12526 WP_003419762.1.1255 WP_003419762.1.12550 WP_003419762.1.12551 WP_003419762.1.12563 WP_003419762.1.12611 WP_003419762.1.12669 WP_003419762.1.1267 WP_003419762.1.12672 WP_003419762.1.12692 WP_003419762.1.1271 WP_003419762.1.12768 WP_003419762.1.1279 WP_003419762.1.12794 WP_003419762.1.12804 WP_003419762.1.12821 WP_003419762.1.12841 WP_003419762.1.12854 WP_003419762.1.12871 WP_003419762.1.12901 WP_003419762.1.12941 WP_003419762.1.12947 WP_003419762.1.12957 WP_003419762.1.12972 WP_003419762.1.13028 WP_003419762.1.13043 WP_003419762.1.13086 WP_003419762.1.13087 WP_003419762.1.13090 WP_003419762.1.13096 WP_003419762.1.13163 WP_003419762.1.13175 WP_003419762.1.13183 WP_003419762.1.132 WP_003419762.1.13249 WP_003419762.1.13282 WP_003419762.1.13284 WP_003419762.1.13296 WP_003419762.1.13298 WP_003419762.1.13302 WP_003419762.1.13306 WP_003419762.1.13312 WP_003419762.1.13313 WP_003419762.1.13321 WP_003419762.1.13345 WP_003419762.1.13358 WP_003419762.1.13370 WP_003419762.1.13375 WP_003419762.1.1338 WP_003419762.1.13420 WP_003419762.1.13433 WP_003419762.1.13435 WP_003419762.1.13438 WP_003419762.1.13461 WP_003419762.1.13466 WP_003419762.1.13489 WP_003419762.1.13526 WP_003419762.1.13551 WP_003419762.1.13561 WP_003419762.1.13564 WP_003419762.1.13579 WP_003419762.1.13647 WP_003419762.1.13667 WP_003419762.1.13687 WP_003419762.1.13697 WP_003419762.1.13719 WP_003419762.1.13763 WP_003419762.1.1377 WP_003419762.1.13774 WP_003419762.1.13786 WP_003419762.1.13793 WP_003419762.1.13794 WP_003419762.1.13817 WP_003419762.1.13834 WP_003419762.1.13866 WP_003419762.1.13880 WP_003419762.1.13899 WP_003419762.1.13909 WP_003419762.1.13910 WP_003419762.1.13919 WP_003419762.1.13920 WP_003419762.1.13952 WP_003419762.1.13953 WP_003419762.1.13962 WP_003419762.1.1398 WP_003419762.1.13988 WP_003419762.1.14027 WP_003419762.1.14046 WP_003419762.1.14115 WP_003419762.1.1415 WP_003419762.1.14152 WP_003419762.1.14158 WP_003419762.1.14162 WP_003419762.1.14175 WP_003419762.1.14178 WP_003419762.1.14194 WP_003419762.1.14195 WP_003419762.1.14208 WP_003419762.1.14238 WP_003419762.1.14266 WP_003419762.1.14273 WP_003419762.1.14303 WP_003419762.1.14306 WP_003419762.1.14307 WP_003419762.1.14310 WP_003419762.1.14341 WP_003419762.1.14382 WP_003419762.1.14416 WP_003419762.1.14428 WP_003419762.1.14441 WP_003419762.1.14469 WP_003419762.1.14477 WP_003419762.1.14504 WP_003419762.1.14514 WP_003419762.1.1452 WP_003419762.1.14527 WP_003419762.1.1454 WP_003419762.1.14544 WP_003419762.1.14548 WP_003419762.1.14551 WP_003419762.1.14561 WP_003419762.1.14573 WP_003419762.1.1462 WP_003419762.1.14667 WP_003419762.1.14668 WP_003419762.1.14675 WP_003419762.1.14694 WP_003419762.1.14695 WP_003419762.1.14709 WP_003419762.1.14766 WP_003419762.1.14783 WP_003419762.1.14865 WP_003419762.1.14872 WP_003419762.1.14905 WP_003419762.1.14926 WP_003419762.1.14951 WP_003419762.1.14955 WP_003419762.1.15003 WP_003419762.1.15009 WP_003419762.1.15028 WP_003419762.1.15040 WP_003419762.1.15052 WP_003419762.1.15065 WP_003419762.1.15072 WP_003419762.1.15089 WP_003419762.1.1509 WP_003419762.1.15126 WP_003419762.1.15131 WP_003419762.1.15168 WP_003419762.1.15172 WP_003419762.1.15174 WP_003419762.1.15187 WP_003419762.1.15196 WP_003419762.1.15210 WP_003419762.1.15216 WP_003419762.1.15217 WP_003419762.1.1523 WP_003419762.1.15232 WP_003419762.1.15238 WP_003419762.1.15240 WP_003419762.1.15253 WP_003419762.1.1527 WP_003419762.1.15292 WP_003419762.1.15299 WP_003419762.1.15302 WP_003419762.1.15322 WP_003419762.1.1534 WP_003419762.1.15365 WP_003419762.1.15372 WP_003419762.1.15386 WP_003419762.1.15387 WP_003419762.1.15442 WP_003419762.1.15447 WP_003419762.1.15449 WP_003419762.1.15477 WP_003419762.1.15481 WP_003419762.1.15492 WP_003419762.1.15511 WP_003419762.1.15512 WP_003419762.1.15558 WP_003419762.1.15559 WP_003419762.1.15566 WP_003419762.1.15599 WP_003419762.1.1560 WP_003419762.1.15611 WP_003419762.1.1563 WP_003419762.1.15633 WP_003419762.1.15643 WP_003419762.1.15688 WP_003419762.1.15755 WP_003419762.1.15763 WP_003419762.1.15774 WP_003419762.1.1578 WP_003419762.1.15780 WP_003419762.1.15827 WP_003419762.1.15834 WP_003419762.1.15842 WP_003419762.1.15848 WP_003419762.1.15853 WP_003419762.1.15870 WP_003419762.1.15877 WP_003419762.1.15893 WP_003419762.1.15896 WP_003419762.1.15926 WP_003419762.1.15933 WP_003419762.1.15946 WP_003419762.1.15958 WP_003419762.1.15973 WP_003419762.1.15987 WP_003419762.1.15993 WP_003419762.1.16009 WP_003419762.1.16025 WP_003419762.1.16043 WP_003419762.1.16055 WP_003419762.1.16066 WP_003419762.1.16069 WP_003419762.1.16077 WP_003419762.1.16106 WP_003419762.1.16108 WP_003419762.1.16110 WP_003419762.1.16130 WP_003419762.1.16136 WP_003419762.1.16139 WP_003419762.1.16141 WP_003419762.1.16143 WP_003419762.1.1630 WP_003419762.1.16318 WP_003419762.1.1632 WP_003419762.1.16327 WP_003419762.1.16334 WP_003419762.1.16341 WP_003419762.1.16345 WP_003419762.1.16374 WP_003419762.1.16384 WP_003419762.1.16386 WP_003419762.1.164 WP_003419762.1.1642 WP_003419762.1.16421 WP_003419762.1.16424 WP_003419762.1.16426 WP_003419762.1.16431 WP_003419762.1.16438 WP_003419762.1.1644 WP_003419762.1.16442 WP_003419762.1.16448 WP_003419762.1.16451 WP_003419762.1.16476 WP_003419762.1.16480 WP_003419762.1.16494 WP_003419762.1.1652 WP_003419762.1.16549 WP_003419762.1.16560 WP_003419762.1.16598 WP_003419762.1.16609 WP_003419762.1.16619 WP_003419762.1.16620 WP_003419762.1.16622 WP_003419762.1.16637 WP_003419762.1.1669 WP_003419762.1.16707 WP_003419762.1.16724 WP_003419762.1.16731 WP_003419762.1.16743 WP_003419762.1.1683 WP_003419762.1.16837 WP_003419762.1.16852 WP_003419762.1.16937 WP_003419762.1.16940 WP_003419762.1.16950 WP_003419762.1.16959 WP_003419762.1.16968 WP_003419762.1.1697 WP_003419762.1.16977 WP_003419762.1.16987 WP_003419762.1.17005 WP_003419762.1.17006 WP_003419762.1.17010 WP_003419762.1.17015 WP_003419762.1.17019 WP_003419762.1.17041 WP_003419762.1.17052 WP_003419762.1.17057 WP_003419762.1.17062 WP_003419762.1.1707 WP_003419762.1.17094 WP_003419762.1.17130 WP_003419762.1.17138 WP_003419762.1.17147 WP_003419762.1.17167 WP_003419762.1.17224 WP_003419762.1.17251 WP_003419762.1.17288 WP_003419762.1.17304 WP_003419762.1.17345 WP_003419762.1.17381 WP_003419762.1.17391 WP_003419762.1.17412 WP_003419762.1.1743 WP_003419762.1.17440 WP_003419762.1.17466 WP_003419762.1.17477 WP_003419762.1.17483 WP_003419762.1.17505 WP_003419762.1.17527 WP_003419762.1.17535 WP_003419762.1.17540 WP_003419762.1.17553 WP_003419762.1.17558 WP_003419762.1.17599 WP_003419762.1.17635 WP_003419762.1.17655 WP_003419762.1.17679 WP_003419762.1.1768 WP_003419762.1.17687 WP_003419762.1.17700 WP_003419762.1.17710 WP_003419762.1.17713 WP_003419762.1.17722 WP_003419762.1.17746 WP_003419762.1.17788 WP_003419762.1.17798 WP_003419762.1.17803 WP_003419762.1.17816 WP_003419762.1.17821 WP_003419762.1.17830 WP_003419762.1.17868 WP_003419762.1.17878 WP_003419762.1.1792 WP_003419762.1.17923 WP_003419762.1.1795 WP_003419762.1.17955 WP_003419762.1.17973 WP_003419762.1.18009 WP_003419762.1.18013 WP_003419762.1.18033 WP_003419762.1.18057 WP_003419762.1.18065 WP_003419762.1.18070 WP_003419762.1.18116 WP_003419762.1.18120 WP_003419762.1.18126 WP_003419762.1.1817 WP_003419762.1.18170 WP_003419762.1.18206 WP_003419762.1.18216 WP_003419762.1.18240 WP_003419762.1.18257 WP_003419762.1.18297 WP_003419762.1.18306 WP_003419762.1.18364 WP_003419762.1.18399 WP_003419762.1.18411 WP_003419762.1.18444 WP_003419762.1.18448 WP_003419762.1.18467 WP_003419762.1.18476 WP_003419762.1.18522 WP_003419762.1.18580 WP_003419762.1.18582 WP_003419762.1.18587 WP_003419762.1.186 WP_003419762.1.18601 WP_003419762.1.18639 WP_003419762.1.18646 WP_003419762.1.18647 WP_003419762.1.1868 WP_003419762.1.18694 WP_003419762.1.18710 WP_003419762.1.18751 WP_003419762.1.18781 WP_003419762.1.18793 WP_003419762.1.18804 WP_003419762.1.18816 WP_003419762.1.18823 WP_003419762.1.18827 WP_003419762.1.18838 WP_003419762.1.18849 WP_003419762.1.18856 WP_003419762.1.18945 WP_003419762.1.1898 WP_003419762.1.19005 WP_003419762.1.19056 WP_003419762.1.19063 WP_003419762.1.19066 WP_003419762.1.19071 WP_003419762.1.19085 WP_003419762.1.19094 WP_003419762.1.19144 WP_003419762.1.19159 WP_003419762.1.19193 WP_003419762.1.19231 WP_003419762.1.19243 WP_003419762.1.19264 WP_003419762.1.19295 WP_003419762.1.19307 WP_003419762.1.19326 WP_003419762.1.1933 WP_003419762.1.19364 WP_003419762.1.19382 WP_003419762.1.19400 WP_003419762.1.19426 WP_003419762.1.19429 WP_003419762.1.19464 WP_003419762.1.19480 WP_003419762.1.19512 WP_003419762.1.19553 WP_003419762.1.19562 WP_003419762.1.19564 WP_003419762.1.19568 WP_003419762.1.19572 WP_003419762.1.19595 WP_003419762.1.19596 WP_003419762.1.19600 WP_003419762.1.19630 WP_003419762.1.1967 WP_003419762.1.19694 WP_003419762.1.1970 WP_003419762.1.19707 WP_003419762.1.19742 WP_003419762.1.19785 WP_003419762.1.19868 WP_003419762.1.19874 WP_003419762.1.19890 WP_003419762.1.19900 WP_003419762.1.19922 WP_003419762.1.19936 WP_003419762.1.19949 WP_003419762.1.19960 WP_003419762.1.19964 WP_003419762.1.20007 WP_003419762.1.20016 WP_003419762.1.20028 WP_003419762.1.2003 WP_003419762.1.20037 WP_003419762.1.20039 WP_003419762.1.20082 WP_003419762.1.20085 WP_003419762.1.20097 WP_003419762.1.20116 WP_003419762.1.20130 WP_003419762.1.20140 WP_003419762.1.20141 WP_003419762.1.20142 WP_003419762.1.20158 WP_003419762.1.20239 WP_003419762.1.20243 WP_003419762.1.20259 WP_003419762.1.20262 WP_003419762.1.20268 WP_003419762.1.20272 WP_003419762.1.20273 WP_003419762.1.20280 WP_003419762.1.20294 WP_003419762.1.20300 WP_003419762.1.20309 WP_003419762.1.20322 WP_003419762.1.2037 WP_003419762.1.20372 WP_003419762.1.20381 WP_003419762.1.204 WP_003419762.1.20427 WP_003419762.1.20432 WP_003419762.1.20457 WP_003419762.1.20459 WP_003419762.1.20460 WP_003419762.1.20542 WP_003419762.1.20578 WP_003419762.1.20608 WP_003419762.1.20624 WP_003419762.1.20628 WP_003419762.1.2066 WP_003419762.1.20707 WP_003419762.1.20722 WP_003419762.1.20729 WP_003419762.1.20742 WP_003419762.1.20751 WP_003419762.1.20776 WP_003419762.1.20843 WP_003419762.1.20850 WP_003419762.1.2086 WP_003419762.1.20868 WP_003419762.1.20876 WP_003419762.1.20897 WP_003419762.1.20898 WP_003419762.1.2090 WP_003419762.1.20911 WP_003419762.1.20916 WP_003419762.1.20921 WP_003419762.1.20926 WP_003419762.1.20927 WP_003419762.1.20951 WP_003419762.1.20970 WP_003419762.1.2104 WP_003419762.1.21070 WP_003419762.1.21127 WP_003419762.1.21135 WP_003419762.1.21173 WP_003419762.1.21187 WP_003419762.1.212 WP_003419762.1.2120 WP_003419762.1.21218 WP_003419762.1.21219 WP_003419762.1.2123 WP_003419762.1.21231 WP_003419762.1.21234 WP_003419762.1.2126 WP_003419762.1.21292 WP_003419762.1.21307 WP_003419762.1.2131 WP_003419762.1.21311 WP_003419762.1.21321 WP_003419762.1.21365 WP_003419762.1.2137 WP_003419762.1.21392 WP_003419762.1.21397 WP_003419762.1.21403 WP_003419762.1.21415 WP_003419762.1.21418 WP_003419762.1.21430 WP_003419762.1.21444 WP_003419762.1.21468 WP_003419762.1.21498 WP_003419762.1.21509 WP_003419762.1.21513 WP_003419762.1.21560 WP_003419762.1.21565 WP_003419762.1.21586 WP_003419762.1.21591 WP_003419762.1.21602 WP_003419762.1.21615 WP_003419762.1.21638 WP_003419762.1.21639 WP_003419762.1.21655 WP_003419762.1.21658 WP_003419762.1.2168 WP_003419762.1.2174 WP_003419762.1.21741 WP_003419762.1.21777 WP_003419762.1.21786 WP_003419762.1.21795 WP_003419762.1.218 WP_003419762.1.21826 WP_003419762.1.21829 WP_003419762.1.21840 WP_003419762.1.21843 WP_003419762.1.21872 WP_003419762.1.21873 WP_003419762.1.2188 WP_003419762.1.21882 WP_003419762.1.21906 WP_003419762.1.21912 WP_003419762.1.2194 WP_003419762.1.21941 WP_003419762.1.21956 WP_003419762.1.21958 WP_003419762.1.21960 WP_003419762.1.21971 WP_003419762.1.21973 WP_003419762.1.21983 WP_003419762.1.22003 WP_003419762.1.22013 WP_003419762.1.22025 WP_003419762.1.22036 WP_003419762.1.22075 WP_003419762.1.22092 WP_003419762.1.2212 WP_003419762.1.22127 WP_003419762.1.22140 WP_003419762.1.22255 WP_003419762.1.22277 WP_003419762.1.22305 WP_003419762.1.22348 WP_003419762.1.22356 WP_003419762.1.22366 WP_003419762.1.2238 WP_003419762.1.22380 WP_003419762.1.22437 WP_003419762.1.22438 WP_003419762.1.22445 WP_003419762.1.22490 WP_003419762.1.22511 WP_003419762.1.22524 WP_003419762.1.2253 WP_003419762.1.22585 WP_003419762.1.22589 WP_003419762.1.22606 WP_003419762.1.22608 WP_003419762.1.22609 WP_003419762.1.22618 WP_003419762.1.2262 WP_003419762.1.22624 WP_003419762.1.22629 WP_003419762.1.22647 WP_003419762.1.22664 WP_003419762.1.22665 WP_003419762.1.22670 WP_003419762.1.22674 WP_003419762.1.22725 WP_003419762.1.22728 WP_003419762.1.22733 WP_003419762.1.22737 WP_003419762.1.2275 WP_003419762.1.22754 WP_003419762.1.22797 WP_003419762.1.22800 WP_003419762.1.22804 WP_003419762.1.22840 WP_003419762.1.22844 WP_003419762.1.22963 WP_003419762.1.22970 WP_003419762.1.22996 WP_003419762.1.22997 WP_003419762.1.22999 WP_003419762.1.23015 WP_003419762.1.23032 WP_003419762.1.231 WP_003419762.1.23101 WP_003419762.1.2312 WP_003419762.1.23153 WP_003419762.1.23171 WP_003419762.1.23199 WP_003419762.1.23204 WP_003419762.1.23216 WP_003419762.1.23229 WP_003419762.1.23233 WP_003419762.1.2326 WP_003419762.1.23261 WP_003419762.1.23272 WP_003419762.1.23289 WP_003419762.1.2329 WP_003419762.1.23308 WP_003419762.1.23316 WP_003419762.1.23321 WP_003419762.1.23325 WP_003419762.1.2339 WP_003419762.1.23406 WP_003419762.1.23438 WP_003419762.1.23445 WP_003419762.1.23447 WP_003419762.1.23452 WP_003419762.1.23461 WP_003419762.1.2349 WP_003419762.1.23496 WP_003419762.1.23506 WP_003419762.1.23530 WP_003419762.1.23539 WP_003419762.1.23546 WP_003419762.1.23551 WP_003419762.1.23573 WP_003419762.1.23583 WP_003419762.1.23588 WP_003419762.1.23628 WP_003419762.1.23677 WP_003419762.1.23683 WP_003419762.1.23692 WP_003419762.1.23694 WP_003419762.1.23699 WP_003419762.1.2371 WP_003419762.1.23803 WP_003419762.1.23807 WP_003419762.1.23825 WP_003419762.1.23832 WP_003419762.1.2384 WP_003419762.1.23843 WP_003419762.1.23863 WP_003419762.1.2387 WP_003419762.1.23894 WP_003419762.1.23993 WP_003419762.1.2400 WP_003419762.1.24007 WP_003419762.1.24008 WP_003419762.1.24046 WP_003419762.1.24057 WP_003419762.1.24113 WP_003419762.1.24119 WP_003419762.1.24128 WP_003419762.1.24140 WP_003419762.1.24176 WP_003419762.1.24190 WP_003419762.1.24202 WP_003419762.1.24244 WP_003419762.1.24261 WP_003419762.1.24284 WP_003419762.1.24294 WP_003419762.1.24357 WP_003419762.1.24396 WP_003419762.1.24414 WP_003419762.1.24423 WP_003419762.1.2443 WP_003419762.1.24446 WP_003419762.1.24461 WP_003419762.1.24500 WP_003419762.1.24507 WP_003419762.1.24509 WP_003419762.1.24529 WP_003419762.1.24553 WP_003419762.1.24599 WP_003419762.1.24629 WP_003419762.1.24638 WP_003419762.1.24648 WP_003419762.1.2466 WP_003419762.1.24767 WP_003419762.1.24824 WP_003419762.1.24831 WP_003419762.1.24840 WP_003419762.1.24848 WP_003419762.1.24857 WP_003419762.1.2487 WP_003419762.1.24893 WP_003419762.1.24907 WP_003419762.1.24933 WP_003419762.1.24956 WP_003419762.1.24958 WP_003419762.1.24985 WP_003419762.1.2499 WP_003419762.1.25004 WP_003419762.1.2505 WP_003419762.1.25051 WP_003419762.1.2507 WP_003419762.1.25096 WP_003419762.1.25103 WP_003419762.1.25129 WP_003419762.1.25171 WP_003419762.1.25184 WP_003419762.1.25247 WP_003419762.1.25252 WP_003419762.1.25278 WP_003419762.1.25283 WP_003419762.1.25309 WP_003419762.1.25313 WP_003419762.1.25338 WP_003419762.1.25342 WP_003419762.1.25343 WP_003419762.1.25367 WP_003419762.1.25393 WP_003419762.1.25406 WP_003419762.1.25435 WP_003419762.1.25437 WP_003419762.1.25445 WP_003419762.1.25455 WP_003419762.1.25473 WP_003419762.1.25504 WP_003419762.1.25513 WP_003419762.1.25542 WP_003419762.1.25579 WP_003419762.1.25594 WP_003419762.1.25606 WP_003419762.1.25645 WP_003419762.1.2566 WP_003419762.1.25673 WP_003419762.1.25674 WP_003419762.1.25693 WP_003419762.1.25699 WP_003419762.1.25727 WP_003419762.1.25736 WP_003419762.1.25738 WP_003419762.1.25756 WP_003419762.1.25759 WP_003419762.1.2580 WP_003419762.1.25813 WP_003419762.1.25853 WP_003419762.1.25854 WP_003419762.1.25874 WP_003419762.1.25885 WP_003419762.1.25892 WP_003419762.1.25906 WP_003419762.1.25914 WP_003419762.1.25916 WP_003419762.1.2594 WP_003419762.1.25954 WP_003419762.1.25972 WP_003419762.1.26017 WP_003419762.1.26032 WP_003419762.1.26038 WP_003419762.1.26072 WP_003419762.1.26089 WP_003419762.1.26097 WP_003419762.1.26098 WP_003419762.1.26108 WP_003419762.1.26109 WP_003419762.1.26118 WP_003419762.1.26126 WP_003419762.1.2614 WP_003419762.1.26168 WP_003419762.1.26182 WP_003419762.1.26190 WP_003419762.1.2620 WP_003419762.1.26234 WP_003419762.1.26243 WP_003419762.1.26267 WP_003419762.1.26292 WP_003419762.1.26310 WP_003419762.1.26328 WP_003419762.1.26349 WP_003419762.1.26366 WP_003419762.1.26374 WP_003419762.1.26407 WP_003419762.1.26454 WP_003419762.1.26464 WP_003419762.1.2653 WP_003419762.1.26560 WP_003419762.1.26571 WP_003419762.1.2659 WP_003419762.1.26597 WP_003419762.1.26603 WP_003419762.1.26629 WP_003419762.1.26651 WP_003419762.1.26702 WP_003419762.1.26707 WP_003419762.1.26710 WP_003419762.1.26719 WP_003419762.1.26737 WP_003419762.1.26738 WP_003419762.1.26745 WP_003419762.1.26756 WP_003419762.1.2676 WP_003419762.1.2677 WP_003419762.1.26779 WP_003419762.1.26780 WP_003419762.1.26798 WP_003419762.1.26854 WP_003419762.1.26868 WP_003419762.1.26876 WP_003419762.1.26888 WP_003419762.1.26914 WP_003419762.1.26945 WP_003419762.1.26959 WP_003419762.1.26969 WP_003419762.1.26984 WP_003419762.1.26992 WP_003419762.1.27004 WP_003419762.1.27017 WP_003419762.1.27045 WP_003419762.1.27074 WP_003419762.1.27075 WP_003419762.1.27128 WP_003419762.1.27130 WP_003419762.1.27139 WP_003419762.1.27152 WP_003419762.1.27162 WP_003419762.1.27164 WP_003419762.1.27193 WP_003419762.1.27235 WP_003419762.1.27278 WP_003419762.1.27343 WP_003419762.1.27352 WP_003419762.1.27369 WP_003419762.1.27391 WP_003419762.1.27398 WP_003419762.1.27402 WP_003419762.1.27410 WP_003419762.1.27411 WP_003419762.1.27449 WP_003419762.1.27460 WP_003419762.1.27463 WP_003419762.1.2749 WP_003419762.1.27528 WP_003419762.1.27541 WP_003419762.1.27576 WP_003419762.1.27582 WP_003419762.1.27596 WP_003419762.1.27607 WP_003419762.1.2766 WP_003419762.1.277 WP_003419762.1.27724 WP_003419762.1.27730 WP_003419762.1.27736 WP_003419762.1.27743 WP_003419762.1.27750 WP_003419762.1.27771 WP_003419762.1.27779 WP_003419762.1.27795 WP_003419762.1.27803 WP_003419762.1.27819 WP_003419762.1.27835 WP_003419762.1.27915 WP_003419762.1.27935 WP_003419762.1.27962 WP_003419762.1.28053 WP_003419762.1.28092 WP_003419762.1.28106 WP_003419762.1.28131 WP_003419762.1.28142 WP_003419762.1.28159 WP_003419762.1.2816 WP_003419762.1.28161 WP_003419762.1.28192 WP_003419762.1.28202 WP_003419762.1.28241 WP_003419762.1.28242 WP_003419762.1.28251 WP_003419762.1.28269 WP_003419762.1.28276 WP_003419762.1.28293 WP_003419762.1.28331 WP_003419762.1.28367 WP_003419762.1.28378 WP_003419762.1.28391 WP_003419762.1.2842 WP_003419762.1.28448 WP_003419762.1.2847 WP_003419762.1.28471 WP_003419762.1.28473 WP_003419762.1.28493 WP_003419762.1.28497 WP_003419762.1.28530 WP_003419762.1.28545 WP_003419762.1.28561 WP_003419762.1.28567 WP_003419762.1.28585 WP_003419762.1.286 WP_003419762.1.28610 WP_003419762.1.28617 WP_003419762.1.28634 WP_003419762.1.28642 WP_003419762.1.28671 WP_003419762.1.28682 WP_003419762.1.28698 WP_003419762.1.28703 WP_003419762.1.28739 WP_003419762.1.28758 WP_003419762.1.28781 WP_003419762.1.28787 WP_003419762.1.28827 WP_003419762.1.28839 WP_003419762.1.28847 WP_003419762.1.28850 WP_003419762.1.28851 WP_003419762.1.28865 WP_003419762.1.28897 WP_003419762.1.28914 WP_003419762.1.28935 WP_003419762.1.28936 WP_003419762.1.28939 WP_003419762.1.28943 WP_003419762.1.28952 WP_003419762.1.28975 WP_003419762.1.2899 WP_003419762.1.28993 WP_003419762.1.29000 WP_003419762.1.2901 WP_003419762.1.29028 WP_003419762.1.29033 WP_003419762.1.29058 WP_003419762.1.29078 WP_003419762.1.29102 WP_003419762.1.29115 WP_003419762.1.2916 WP_003419762.1.29217 WP_003419762.1.29223 WP_003419762.1.29234 WP_003419762.1.29264 WP_003419762.1.29275 WP_003419762.1.29306 WP_003419762.1.29339 WP_003419762.1.29348 WP_003419762.1.29364 WP_003419762.1.29367 WP_003419762.1.2938 WP_003419762.1.29399 WP_003419762.1.29426 WP_003419762.1.2944 WP_003419762.1.29449 WP_003419762.1.29450 WP_003419762.1.29452 WP_003419762.1.2949 WP_003419762.1.29510 WP_003419762.1.29515 WP_003419762.1.29525 WP_003419762.1.2953 WP_003419762.1.29587 WP_003419762.1.2959 WP_003419762.1.29592 WP_003419762.1.29599 WP_003419762.1.29611 WP_003419762.1.29632 WP_003419762.1.29649 WP_003419762.1.2965 WP_003419762.1.29659 WP_003419762.1.2969 WP_003419762.1.29696 WP_003419762.1.29698 WP_003419762.1.29718 WP_003419762.1.29742 WP_003419762.1.29745 WP_003419762.1.29747 WP_003419762.1.29769 WP_003419762.1.29825 WP_003419762.1.29830 WP_003419762.1.29847 WP_003419762.1.29861 WP_003419762.1.29869 WP_003419762.1.29883 WP_003419762.1.29890 WP_003419762.1.299 WP_003419762.1.29931 WP_003419762.1.29960 WP_003419762.1.30014 WP_003419762.1.3004 WP_003419762.1.30040 WP_003419762.1.30043 WP_003419762.1.30074 WP_003419762.1.30097 WP_003419762.1.30101 WP_003419762.1.30106 WP_003419762.1.30114 WP_003419762.1.30126 WP_003419762.1.30131 WP_003419762.1.30138 WP_003419762.1.30139 WP_003419762.1.30145 WP_003419762.1.30211 WP_003419762.1.30224 WP_003419762.1.30235 WP_003419762.1.30237 WP_003419762.1.3027 WP_003419762.1.30279 WP_003419762.1.30282 WP_003419762.1.30283 WP_003419762.1.30288 WP_003419762.1.30291 WP_003419762.1.30363 WP_003419762.1.30374 WP_003419762.1.30404 WP_003419762.1.3043 WP_003419762.1.30433 WP_003419762.1.30438 WP_003419762.1.30462 WP_003419762.1.30464 WP_003419762.1.30468 WP_003419762.1.30500 WP_003419762.1.3057 WP_003419762.1.30574 WP_003419762.1.30628 WP_003419762.1.30641 WP_003419762.1.30642 WP_003419762.1.30661 WP_003419762.1.30683 WP_003419762.1.30699 WP_003419762.1.30709 WP_003419762.1.30713 WP_003419762.1.30716 WP_003419762.1.30719 WP_003419762.1.30730 WP_003419762.1.30736 WP_003419762.1.30745 WP_003419762.1.30760 WP_003419762.1.30791 WP_003419762.1.308 WP_003419762.1.30807 WP_003419762.1.30818 WP_003419762.1.30824 WP_003419762.1.30848 WP_003419762.1.30877 WP_003419762.1.30888 WP_003419762.1.30901 WP_003419762.1.30903 WP_003419762.1.30912 WP_003419762.1.30913 WP_003419762.1.30914 WP_003419762.1.30919 WP_003419762.1.30977 WP_003419762.1.3100 WP_003419762.1.31002 WP_003419762.1.3101 WP_003419762.1.31034 WP_003419762.1.31047 WP_003419762.1.31070 WP_003419762.1.31074 WP_003419762.1.31102 WP_003419762.1.31127 WP_003419762.1.31184 WP_003419762.1.31199 WP_003419762.1.31226 WP_003419762.1.31230 WP_003419762.1.31233 WP_003419762.1.31263 WP_003419762.1.31264 WP_003419762.1.31270 WP_003419762.1.31287 WP_003419762.1.31290 WP_003419762.1.31304 WP_003419762.1.31346 WP_003419762.1.31348 WP_003419762.1.31354 WP_003419762.1.31390 WP_003419762.1.31414 WP_003419762.1.31417 WP_003419762.1.31428 WP_003419762.1.3143 WP_003419762.1.31458 WP_003419762.1.31483 WP_003419762.1.3149 WP_003419762.1.31498 WP_003419762.1.31507 WP_003419762.1.31537 WP_003419762.1.31548 WP_003419762.1.31569 WP_003419762.1.31573 WP_003419762.1.316 WP_003419762.1.31629 WP_003419762.1.31666 WP_003419762.1.31693 WP_003419762.1.31703 WP_003419762.1.31744 WP_003419762.1.31745 WP_003419762.1.31770 WP_003419762.1.31776 WP_003419762.1.31783 WP_003419762.1.318 WP_003419762.1.3184 WP_003419762.1.31840 WP_003419762.1.31880 WP_003419762.1.31911 WP_003419762.1.31930 WP_003419762.1.31932 WP_003419762.1.31955 WP_003419762.1.31985 WP_003419762.1.31991 WP_003419762.1.31995 WP_003419762.1.32004 WP_003419762.1.32039 WP_003419762.1.3204 WP_003419762.1.32045 WP_003419762.1.32071 WP_003419762.1.32098 WP_003419762.1.32132 WP_003419762.1.32157 WP_003419762.1.32164 WP_003419762.1.32179 WP_003419762.1.32198 WP_003419762.1.32297 WP_003419762.1.32317 WP_003419762.1.32383 WP_003419762.1.32400 WP_003419762.1.32403 WP_003419762.1.32416 WP_003419762.1.32421 WP_003419762.1.32433 WP_003419762.1.32461 WP_003419762.1.32482 WP_003419762.1.32503 WP_003419762.1.32556 WP_003419762.1.32562 WP_003419762.1.32569 WP_003419762.1.32592 WP_003419762.1.32620 WP_003419762.1.32647 WP_003419762.1.32653 WP_003419762.1.32654 WP_003419762.1.3268 WP_003419762.1.32695 WP_003419762.1.32706 WP_003419762.1.32716 WP_003419762.1.32738 WP_003419762.1.32752 WP_003419762.1.32780 WP_003419762.1.32781 WP_003419762.1.32793 WP_003419762.1.32799 WP_003419762.1.32833 WP_003419762.1.32862 WP_003419762.1.32880 WP_003419762.1.32897 WP_003419762.1.32909 WP_003419762.1.32935 WP_003419762.1.32974 WP_003419762.1.33007 WP_003419762.1.3302 WP_003419762.1.33028 WP_003419762.1.33035 WP_003419762.1.33044 WP_003419762.1.33082 WP_003419762.1.33141 WP_003419762.1.33148 WP_003419762.1.33155 WP_003419762.1.33168 WP_003419762.1.3321 WP_003419762.1.33215 WP_003419762.1.3325 WP_003419762.1.3327 WP_003419762.1.33278 WP_003419762.1.33288 WP_003419762.1.33305 WP_003419762.1.3331 WP_003419762.1.33319 WP_003419762.1.3333 WP_003419762.1.33393 WP_003419762.1.33403 WP_003419762.1.33452 WP_003419762.1.33467 WP_003419762.1.33477 WP_003419762.1.3349 WP_003419762.1.33519 WP_003419762.1.33542 WP_003419762.1.33601 WP_003419762.1.33602 WP_003419762.1.33633 WP_003419762.1.33646 WP_003419762.1.33673 WP_003419762.1.3369 WP_003419762.1.33705 WP_003419762.1.33762 WP_003419762.1.33783 WP_003419762.1.33789 WP_003419762.1.3383 WP_003419762.1.33832 WP_003419762.1.33839 WP_003419762.1.33848 WP_003419762.1.3387 WP_003419762.1.33886 WP_003419762.1.33895 WP_003419762.1.33906 WP_003419762.1.33912 WP_003419762.1.33954 WP_003419762.1.3399 WP_003419762.1.34042 WP_003419762.1.3405 WP_003419762.1.34055 WP_003419762.1.34056 WP_003419762.1.34065 WP_003419762.1.3408 WP_003419762.1.34090 WP_003419762.1.34109 WP_003419762.1.34131 WP_003419762.1.34152 WP_003419762.1.34153 WP_003419762.1.34163 WP_003419762.1.34181 WP_003419762.1.34197 WP_003419762.1.34198 WP_003419762.1.34215 WP_003419762.1.34219 WP_003419762.1.34255 WP_003419762.1.34260 WP_003419762.1.34275 WP_003419762.1.343 WP_003419762.1.34347 WP_003419762.1.34392 WP_003419762.1.344 WP_003419762.1.34428 WP_003419762.1.3443 WP_003419762.1.34435 WP_003419762.1.34446 WP_003419762.1.34499 WP_003419762.1.34505 WP_003419762.1.34516 WP_003419762.1.34529 WP_003419762.1.34551 WP_003419762.1.34563 WP_003419762.1.34576 WP_003419762.1.34581 WP_003419762.1.34588 WP_003419762.1.34596 WP_003419762.1.34599 WP_003419762.1.34639 WP_003419762.1.34673 WP_003419762.1.34724 WP_003419762.1.34740 WP_003419762.1.34755 WP_003419762.1.34777 WP_003419762.1.34783 WP_003419762.1.34841 WP_003419762.1.34908 WP_003419762.1.34919 WP_003419762.1.3492 WP_003419762.1.34933 WP_003419762.1.34945 WP_003419762.1.34946 WP_003419762.1.34954 WP_003419762.1.34960 WP_003419762.1.34961 WP_003419762.1.34963 WP_003419762.1.34965 WP_003419762.1.34968 WP_003419762.1.35023 WP_003419762.1.35069 WP_003419762.1.35072 WP_003419762.1.35078 WP_003419762.1.35100 WP_003419762.1.35146 WP_003419762.1.35156 WP_003419762.1.35160 WP_003419762.1.35162 WP_003419762.1.35176 WP_003419762.1.3520 WP_003419762.1.35213 WP_003419762.1.35221 WP_003419762.1.35246 WP_003419762.1.35278 WP_003419762.1.35301 WP_003419762.1.35311 WP_003419762.1.35312 WP_003419762.1.35317 WP_003419762.1.35319 WP_003419762.1.35347 WP_003419762.1.35363 WP_003419762.1.35382 WP_003419762.1.35385 WP_003419762.1.35396 WP_003419762.1.35397 WP_003419762.1.35403 WP_003419762.1.35426 WP_003419762.1.35439 WP_003419762.1.35455 WP_003419762.1.3548 WP_003419762.1.35484 WP_003419762.1.35492 WP_003419762.1.3553 WP_003419762.1.35553 WP_003419762.1.35555 WP_003419762.1.35561 WP_003419762.1.35602 WP_003419762.1.35610 WP_003419762.1.35635 WP_003419762.1.35657 WP_003419762.1.35687 WP_003419762.1.35689 WP_003419762.1.35707 WP_003419762.1.35732 WP_003419762.1.35754 WP_003419762.1.35767 WP_003419762.1.35770 WP_003419762.1.35771 WP_003419762.1.35780 WP_003419762.1.35805 WP_003419762.1.35811 WP_003419762.1.35821 WP_003419762.1.3584 WP_003419762.1.35848 WP_003419762.1.35864 WP_003419762.1.35874 WP_003419762.1.35876 WP_003419762.1.35897 WP_003419762.1.35899 WP_003419762.1.35923 WP_003419762.1.3593 WP_003419762.1.35954 WP_003419762.1.36005 WP_003419762.1.36014 WP_003419762.1.36023 WP_003419762.1.36051 WP_003419762.1.36053 WP_003419762.1.36075 WP_003419762.1.36089 WP_003419762.1.36097 WP_003419762.1.36098 WP_003419762.1.36116 WP_003419762.1.36145 WP_003419762.1.36156 WP_003419762.1.36205 WP_003419762.1.36228 WP_003419762.1.36252 WP_003419762.1.36260 WP_003419762.1.36270 WP_003419762.1.36271 WP_003419762.1.36303 WP_003419762.1.36309 WP_003419762.1.36315 WP_003419762.1.36319 WP_003419762.1.36321 WP_003419762.1.36326 WP_003419762.1.3634 WP_003419762.1.36356 WP_003419762.1.36357 WP_003419762.1.3636 WP_003419762.1.36385 WP_003419762.1.36399 WP_003419762.1.36436 WP_003419762.1.36465 WP_003419762.1.36469 WP_003419762.1.36473 WP_003419762.1.36485 WP_003419762.1.36508 WP_003419762.1.36540 WP_003419762.1.36561 WP_003419762.1.36571 WP_003419762.1.36573 WP_003419762.1.36578 WP_003419762.1.36585 WP_003419762.1.36597 WP_003419762.1.36614 WP_003419762.1.36674 WP_003419762.1.36720 WP_003419762.1.36727 WP_003419762.1.36733 WP_003419762.1.36785 WP_003419762.1.36810 WP_003419762.1.36844 WP_003419762.1.36851 WP_003419762.1.36862 WP_003419762.1.36893 WP_003419762.1.36901 WP_003419762.1.36921 WP_003419762.1.36935 WP_003419762.1.36941 WP_003419762.1.3695 WP_003419762.1.36951 WP_003419762.1.36968 WP_003419762.1.3700 WP_003419762.1.37004 WP_003419762.1.37012 WP_003419762.1.37071 WP_003419762.1.37088 WP_003419762.1.37131 WP_003419762.1.37157 WP_003419762.1.37175 WP_003419762.1.37188 WP_003419762.1.37213 WP_003419762.1.37229 WP_003419762.1.3724 WP_003419762.1.37277 WP_003419762.1.37305 WP_003419762.1.37330 WP_003419762.1.37389 WP_003419762.1.37400 WP_003419762.1.37440 WP_003419762.1.37459 WP_003419762.1.37468 WP_003419762.1.37475 WP_003419762.1.37484 WP_003419762.1.37601 WP_003419762.1.37612 WP_003419762.1.37632 WP_003419762.1.37643 WP_003419762.1.37655 WP_003419762.1.37660 WP_003419762.1.37674 WP_003419762.1.37700 WP_003419762.1.37701 WP_003419762.1.37709 WP_003419762.1.37711 WP_003419762.1.37721 WP_003419762.1.37722 WP_003419762.1.37747 WP_003419762.1.37765 WP_003419762.1.37772 WP_003419762.1.37804 WP_003419762.1.37809 WP_003419762.1.37859 WP_003419762.1.37877 WP_003419762.1.37912 WP_003419762.1.37913 WP_003419762.1.37943 WP_003419762.1.37950 WP_003419762.1.37973 WP_003419762.1.37975 WP_003419762.1.37983 WP_003419762.1.38 WP_003419762.1.38002 WP_003419762.1.3802 WP_003419762.1.38039 WP_003419762.1.38040 WP_003419762.1.38067 WP_003419762.1.38068 WP_003419762.1.38138 WP_003419762.1.38144 WP_003419762.1.38158 WP_003419762.1.38159 WP_003419762.1.38210 WP_003419762.1.38233 WP_003419762.1.38240 WP_003419762.1.38299 WP_003419762.1.38332 WP_003419762.1.38347 WP_003419762.1.38354 WP_003419762.1.38380 WP_003419762.1.38384 WP_003419762.1.38389 WP_003419762.1.38398 WP_003419762.1.38402 WP_003419762.1.38418 WP_003419762.1.38421 WP_003419762.1.38466 WP_003419762.1.38477 WP_003419762.1.38483 WP_003419762.1.3849 WP_003419762.1.385 WP_003419762.1.38530 WP_003419762.1.38535 WP_003419762.1.38539 WP_003419762.1.38594 WP_003419762.1.38601 WP_003419762.1.38611 WP_003419762.1.38638 WP_003419762.1.38639 WP_003419762.1.38646 WP_003419762.1.38648 WP_003419762.1.38654 WP_003419762.1.38659 WP_003419762.1.38660 WP_003419762.1.38666 WP_003419762.1.38671 WP_003419762.1.38672 WP_003419762.1.38677 WP_003419762.1.38750 WP_003419762.1.38772 WP_003419762.1.38812 WP_003419762.1.38821 WP_003419762.1.38844 WP_003419762.1.38863 WP_003419762.1.38865 WP_003419762.1.38873 WP_003419762.1.3889 WP_003419762.1.38894 WP_003419762.1.38909 WP_003419762.1.38939 WP_003419762.1.38974 WP_003419762.1.38975 WP_003419762.1.38991 WP_003419762.1.39025 WP_003419762.1.39070 WP_003419762.1.39072 WP_003419762.1.39095 WP_003419762.1.39106 WP_003419762.1.39165 WP_003419762.1.39174 WP_003419762.1.39176 WP_003419762.1.39178 WP_003419762.1.39190 WP_003419762.1.39201 WP_003419762.1.39207 WP_003419762.1.39211 WP_003419762.1.39236 WP_003419762.1.39239 WP_003419762.1.39252 WP_003419762.1.39288 WP_003419762.1.39295 WP_003419762.1.39306 WP_003419762.1.39359 WP_003419762.1.39364 WP_003419762.1.39400 WP_003419762.1.39447 WP_003419762.1.3945 WP_003419762.1.39450 WP_003419762.1.39455 WP_003419762.1.3949 WP_003419762.1.39521 WP_003419762.1.39560 WP_003419762.1.39592 WP_003419762.1.39593 WP_003419762.1.396 WP_003419762.1.3960 WP_003419762.1.39616 WP_003419762.1.39654 WP_003419762.1.39657 WP_003419762.1.39661 WP_003419762.1.39674 WP_003419762.1.39678 WP_003419762.1.3968 WP_003419762.1.39694 WP_003419762.1.3971 WP_003419762.1.39718 WP_003419762.1.39728 WP_003419762.1.39739 WP_003419762.1.39748 WP_003419762.1.39751 WP_003419762.1.39759 WP_003419762.1.39801 WP_003419762.1.39804 WP_003419762.1.39848 WP_003419762.1.39877 WP_003419762.1.39925 WP_003419762.1.3994 WP_003419762.1.39959 WP_003419762.1.3996 WP_003419762.1.39960 WP_003419762.1.3997 WP_003419762.1.39980 WP_003419762.1.40000 WP_003419762.1.40028 WP_003419762.1.40029 WP_003419762.1.4003 WP_003419762.1.40094 WP_003419762.1.40096 WP_003419762.1.40150 WP_003419762.1.40156 WP_003419762.1.40174 WP_003419762.1.40186 WP_003419762.1.40276 WP_003419762.1.40277 WP_003419762.1.40323 WP_003419762.1.40336 WP_003419762.1.40353 WP_003419762.1.4036 WP_003419762.1.40372 WP_003419762.1.40402 WP_003419762.1.40413 WP_003419762.1.40440 WP_003419762.1.40446 WP_003419762.1.40451 WP_003419762.1.40455 WP_003419762.1.40523 WP_003419762.1.40543 WP_003419762.1.40641 WP_003419762.1.40646 WP_003419762.1.40651 WP_003419762.1.40653 WP_003419762.1.4067 WP_003419762.1.40705 WP_003419762.1.40723 WP_003419762.1.40731 WP_003419762.1.40735 WP_003419762.1.40795 WP_003419762.1.40799 WP_003419762.1.40852 WP_003419762.1.40876 WP_003419762.1.40881 WP_003419762.1.40922 WP_003419762.1.40948 WP_003419762.1.4095 WP_003419762.1.40956 WP_003419762.1.40957 WP_003419762.1.40964 WP_003419762.1.4097 WP_003419762.1.410 WP_003419762.1.41000 WP_003419762.1.41055 WP_003419762.1.41108 WP_003419762.1.41123 WP_003419762.1.41177 WP_003419762.1.41202 WP_003419762.1.41219 WP_003419762.1.41231 WP_003419762.1.41249 WP_003419762.1.4127 WP_003419762.1.41296 WP_003419762.1.41355 WP_003419762.1.41376 WP_003419762.1.41430 WP_003419762.1.41447 WP_003419762.1.41469 WP_003419762.1.41504 WP_003419762.1.41553 WP_003419762.1.41564 WP_003419762.1.41616 WP_003419762.1.41632 WP_003419762.1.41635 WP_003419762.1.41636 WP_003419762.1.41648 WP_003419762.1.41660 WP_003419762.1.41685 WP_003419762.1.41695 WP_003419762.1.41704 WP_003419762.1.4171 WP_003419762.1.41719 WP_003419762.1.41733 WP_003419762.1.41744 WP_003419762.1.41774 WP_003419762.1.41791 WP_003419762.1.41803 WP_003419762.1.41820 WP_003419762.1.41828 WP_003419762.1.41829 WP_003419762.1.41860 WP_003419762.1.41912 WP_003419762.1.41921 WP_003419762.1.41933 WP_003419762.1.41944 WP_003419762.1.42043 WP_003419762.1.42075 WP_003419762.1.42078 WP_003419762.1.42094 WP_003419762.1.42112 WP_003419762.1.4212 WP_003419762.1.42122 WP_003419762.1.42134 WP_003419762.1.42183 WP_003419762.1.42188 WP_003419762.1.42202 WP_003419762.1.42208 WP_003419762.1.42247 WP_003419762.1.42255 WP_003419762.1.42273 WP_003419762.1.42278 WP_003419762.1.42304 WP_003419762.1.42309 WP_003419762.1.42370 WP_003419762.1.42385 WP_003419762.1.42400 WP_003419762.1.42409 WP_003419762.1.42414 WP_003419762.1.42430 WP_003419762.1.42461 WP_003419762.1.42465 WP_003419762.1.42467 WP_003419762.1.42473 WP_003419762.1.42474 WP_003419762.1.4248 WP_003419762.1.42494 WP_003419762.1.42519 WP_003419762.1.42524 WP_003419762.1.42534 WP_003419762.1.4255 WP_003419762.1.42562 WP_003419762.1.42570 WP_003419762.1.42618 WP_003419762.1.42660 WP_003419762.1.42695 WP_003419762.1.42704 WP_003419762.1.42705 WP_003419762.1.42722 WP_003419762.1.42777 WP_003419762.1.42782 WP_003419762.1.42835 WP_003419762.1.42839 WP_003419762.1.42842 WP_003419762.1.42905 WP_003419762.1.42916 WP_003419762.1.42930 WP_003419762.1.42971 WP_003419762.1.43005 WP_003419762.1.43009 WP_003419762.1.43053 WP_003419762.1.43082 WP_003419762.1.43087 WP_003419762.1.43098 WP_003419762.1.43208 WP_003419762.1.43236 WP_003419762.1.43246 WP_003419762.1.43255 WP_003419762.1.43266 WP_003419762.1.43269 WP_003419762.1.43273 WP_003419762.1.43296 WP_003419762.1.43306 WP_003419762.1.4335 WP_003419762.1.43368 WP_003419762.1.43395 WP_003419762.1.43457 WP_003419762.1.43462 WP_003419762.1.43475 WP_003419762.1.43478 WP_003419762.1.43484 WP_003419762.1.43557 WP_003419762.1.43578 WP_003419762.1.43588 WP_003419762.1.43643 WP_003419762.1.43664 WP_003419762.1.43684 WP_003419762.1.43686 WP_003419762.1.43706 WP_003419762.1.43716 WP_003419762.1.4377 WP_003419762.1.43781 WP_003419762.1.43794 WP_003419762.1.43815 WP_003419762.1.43846 WP_003419762.1.43861 WP_003419762.1.43863 WP_003419762.1.43866 WP_003419762.1.43872 WP_003419762.1.43885 WP_003419762.1.43897 WP_003419762.1.4390 WP_003419762.1.43902 WP_003419762.1.43921 WP_003419762.1.43936 WP_003419762.1.43937 WP_003419762.1.43960 WP_003419762.1.43965 WP_003419762.1.4399 WP_003419762.1.43993 WP_003419762.1.43996 WP_003419762.1.44 WP_003419762.1.44001 WP_003419762.1.44008 WP_003419762.1.44033 WP_003419762.1.44037 WP_003419762.1.44041 WP_003419762.1.44070 WP_003419762.1.44071 WP_003419762.1.44076 WP_003419762.1.44104 WP_003419762.1.44111 WP_003419762.1.44124 WP_003419762.1.44169 WP_003419762.1.44219 WP_003419762.1.44237 WP_003419762.1.44277 WP_003419762.1.44279 WP_003419762.1.44336 WP_003419762.1.44355 WP_003419762.1.44358 WP_003419762.1.4438 WP_003419762.1.44390 WP_003419762.1.44392 WP_003419762.1.4441 WP_003419762.1.44415 WP_003419762.1.44464 WP_003419762.1.44466 WP_003419762.1.44489 WP_003419762.1.44492 WP_003419762.1.44494 WP_003419762.1.44500 WP_003419762.1.44519 WP_003419762.1.44526 WP_003419762.1.44532 WP_003419762.1.44534 WP_003419762.1.44562 WP_003419762.1.44589 WP_003419762.1.44597 WP_003419762.1.44600 WP_003419762.1.44602 WP_003419762.1.44615 WP_003419762.1.4464 WP_003419762.1.44651 WP_003419762.1.44659 WP_003419762.1.44665 WP_003419762.1.44694 WP_003419762.1.44700 WP_003419762.1.44713 WP_003419762.1.44735 WP_003419762.1.44740 WP_003419762.1.44757 WP_003419762.1.4476 WP_003419762.1.44761 WP_003419762.1.44767 WP_003419762.1.44776 WP_003419762.1.44779 WP_003419762.1.44786 WP_003419762.1.44808 WP_003419762.1.44864 WP_003419762.1.44901 WP_003419762.1.44908 WP_003419762.1.44913 WP_003419762.1.4492 WP_003419762.1.44939 WP_003419762.1.44979 WP_003419762.1.44981 WP_003419762.1.45002 WP_003419762.1.45011 WP_003419762.1.4504 WP_003419762.1.45062 WP_003419762.1.45066 WP_003419762.1.45081 WP_003419762.1.45113 WP_003419762.1.45129 WP_003419762.1.45135 WP_003419762.1.45147 WP_003419762.1.45168 WP_003419762.1.4517 WP_003419762.1.45181 WP_003419762.1.45185 WP_003419762.1.45192 WP_003419762.1.45200 WP_003419762.1.45205 WP_003419762.1.45211 WP_003419762.1.45249 WP_003419762.1.4526 WP_003419762.1.45286 WP_003419762.1.45326 WP_003419762.1.45347 WP_003419762.1.45374 WP_003419762.1.45390 WP_003419762.1.454 WP_003419762.1.45407 WP_003419762.1.45451 WP_003419762.1.45453 WP_003419762.1.45460 WP_003419762.1.45463 WP_003419762.1.45470 WP_003419762.1.45474 WP_003419762.1.45491 WP_003419762.1.45510 WP_003419762.1.45563 WP_003419762.1.45584 WP_003419762.1.45590 WP_003419762.1.45619 WP_003419762.1.45626 WP_003419762.1.45631 WP_003419762.1.45666 WP_003419762.1.45697 WP_003419762.1.4571 WP_003419762.1.45731 WP_003419762.1.45743 WP_003419762.1.45765 WP_003419762.1.45776 WP_003419762.1.45783 WP_003419762.1.45805 WP_003419762.1.45815 WP_003419762.1.45849 WP_003419762.1.45867 WP_003419762.1.45884 WP_003419762.1.4590 WP_003419762.1.45923 WP_003419762.1.45926 WP_003419762.1.45963 WP_003419762.1.45989 WP_003419762.1.45992 WP_003419762.1.46025 WP_003419762.1.46083 WP_003419762.1.46090 WP_003419762.1.46092 WP_003419762.1.46100 WP_003419762.1.46101 WP_003419762.1.46103 WP_003419762.1.46107 WP_003419762.1.46127 WP_003419762.1.46128 WP_003419762.1.46129 WP_003419762.1.46141 WP_003419762.1.46150 WP_003419762.1.46201 WP_003419762.1.46226 WP_003419762.1.4624 WP_003419762.1.46253 WP_003419762.1.46268 WP_003419762.1.46285 WP_003419762.1.46300 WP_003419762.1.46313 WP_003419762.1.46336 WP_003419762.1.46365 WP_003419762.1.46370 WP_003419762.1.46381 WP_003419762.1.46411 WP_003419762.1.4644 WP_003419762.1.46442 WP_003419762.1.46453 WP_003419762.1.46463 WP_003419762.1.46478 WP_003419762.1.46492 WP_003419762.1.46521 WP_003419762.1.4653 WP_003419762.1.46532 WP_003419762.1.46539 WP_003419762.1.46568 WP_003419762.1.46585 WP_003419762.1.46609 WP_003419762.1.46613 WP_003419762.1.46625 WP_003419762.1.46642 WP_003419762.1.46647 WP_003419762.1.46674 WP_003419762.1.46724 WP_003419762.1.46758 WP_003419762.1.46773 WP_003419762.1.46777 WP_003419762.1.46786 WP_003419762.1.46792 WP_003419762.1.46847 WP_003419762.1.46851 WP_003419762.1.4687 WP_003419762.1.46897 WP_003419762.1.46936 WP_003419762.1.46980 WP_003419762.1.47011 WP_003419762.1.47012 WP_003419762.1.47066 WP_003419762.1.47077 WP_003419762.1.47083 WP_003419762.1.47106 WP_003419762.1.47142 WP_003419762.1.47147 WP_003419762.1.47166 WP_003419762.1.47178 WP_003419762.1.47179 WP_003419762.1.47194 WP_003419762.1.47207 WP_003419762.1.47210 WP_003419762.1.47261 WP_003419762.1.47262 WP_003419762.1.47402 WP_003419762.1.47423 WP_003419762.1.47467 WP_003419762.1.47502 WP_003419762.1.4751 WP_003419762.1.47511 WP_003419762.1.47537 WP_003419762.1.47540 WP_003419762.1.47568 WP_003419762.1.47572 WP_003419762.1.47588 WP_003419762.1.47636 WP_003419762.1.4764 WP_003419762.1.47653 WP_003419762.1.47679 WP_003419762.1.47681 WP_003419762.1.47690 WP_003419762.1.4771 WP_003419762.1.47717 WP_003419762.1.47743 WP_003419762.1.47754 WP_003419762.1.47773 WP_003419762.1.47776 WP_003419762.1.47780 WP_003419762.1.47805 WP_003419762.1.47832 WP_003419762.1.47847 WP_003419762.1.47858 WP_003419762.1.47861 WP_003419762.1.47868 WP_003419762.1.47893 WP_003419762.1.47899 WP_003419762.1.479 WP_003419762.1.47912 WP_003419762.1.47913 WP_003419762.1.47926 WP_003419762.1.4794 WP_003419762.1.47943 WP_003419762.1.47944 WP_003419762.1.47959 WP_003419762.1.47974 WP_003419762.1.47993 WP_003419762.1.48004 WP_003419762.1.48039 WP_003419762.1.48050 WP_003419762.1.48084 WP_003419762.1.48097 WP_003419762.1.48101 WP_003419762.1.4813 WP_003419762.1.48130 WP_003419762.1.48135 WP_003419762.1.48143 WP_003419762.1.48152 WP_003419762.1.48155 WP_003419762.1.48170 WP_003419762.1.48173 WP_003419762.1.48177 WP_003419762.1.48185 WP_003419762.1.48204 WP_003419762.1.48219 WP_003419762.1.4823 WP_003419762.1.48240 WP_003419762.1.48256 WP_003419762.1.48264 WP_003419762.1.48287 WP_003419762.1.48330 WP_003419762.1.48333 WP_003419762.1.48348 WP_003419762.1.48354 WP_003419762.1.48372 WP_003419762.1.48383 WP_003419762.1.48388 WP_003419762.1.48419 WP_003419762.1.48423 WP_003419762.1.48443 WP_003419762.1.48450 WP_003419762.1.48462 WP_003419762.1.48543 WP_003419762.1.48550 WP_003419762.1.48605 WP_003419762.1.48618 WP_003419762.1.4863 WP_003419762.1.48648 WP_003419762.1.48658 WP_003419762.1.48666 WP_003419762.1.48687 WP_003419762.1.48779 WP_003419762.1.4878 WP_003419762.1.48798 WP_003419762.1.48802 WP_003419762.1.48826 WP_003419762.1.48831 WP_003419762.1.48843 WP_003419762.1.48857 WP_003419762.1.4890 WP_003419762.1.48946 WP_003419762.1.48979 WP_003419762.1.49017 WP_003419762.1.49048 WP_003419762.1.49059 WP_003419762.1.4906 WP_003419762.1.4907 WP_003419762.1.49103 WP_003419762.1.49110 WP_003419762.1.49111 WP_003419762.1.49112 WP_003419762.1.4919 WP_003419762.1.49251 WP_003419762.1.49254 WP_003419762.1.49263 WP_003419762.1.49291 WP_003419762.1.49296 WP_003419762.1.49335 WP_003419762.1.49337 WP_003419762.1.49419 WP_003419762.1.49426 WP_003419762.1.49437 WP_003419762.1.49439 WP_003419762.1.49474 WP_003419762.1.49506 WP_003419762.1.49516 WP_003419762.1.49523 WP_003419762.1.49526 WP_003419762.1.49532 WP_003419762.1.49588 WP_003419762.1.4959 WP_003419762.1.49678 WP_003419762.1.49687 WP_003419762.1.49699 WP_003419762.1.49709 WP_003419762.1.4971 WP_003419762.1.4972 WP_003419762.1.49736 WP_003419762.1.49746 WP_003419762.1.49764 WP_003419762.1.49773 WP_003419762.1.49796 WP_003419762.1.49814 WP_003419762.1.49815 WP_003419762.1.49816 WP_003419762.1.49839 WP_003419762.1.49857 WP_003419762.1.49878 WP_003419762.1.49880 WP_003419762.1.49944 WP_003419762.1.4999 WP_003419762.1.49990 WP_003419762.1.50068 WP_003419762.1.50077 WP_003419762.1.5008 WP_003419762.1.50081 WP_003419762.1.50122 WP_003419762.1.50126 WP_003419762.1.50149 WP_003419762.1.50162 WP_003419762.1.5018 WP_003419762.1.50194 WP_003419762.1.50218 WP_003419762.1.50235 WP_003419762.1.50249 WP_003419762.1.50265 WP_003419762.1.50271 WP_003419762.1.50324 WP_003419762.1.50347 WP_003419762.1.50372 WP_003419762.1.50398 WP_003419762.1.50407 WP_003419762.1.50444 WP_003419762.1.50466 WP_003419762.1.50472 WP_003419762.1.5048 WP_003419762.1.50498 WP_003419762.1.5050 WP_003419762.1.50540 WP_003419762.1.50554 WP_003419762.1.50557 WP_003419762.1.50601 WP_003419762.1.50610 WP_003419762.1.50632 WP_003419762.1.50633 WP_003419762.1.50642 WP_003419762.1.50655 WP_003419762.1.50659 WP_003419762.1.50683 WP_003419762.1.50689 WP_003419762.1.50692 WP_003419762.1.50714 WP_003419762.1.50729 WP_003419762.1.50756 WP_003419762.1.50784 WP_003419762.1.50794 WP_003419762.1.50841 WP_003419762.1.50860 WP_003419762.1.50877 WP_003419762.1.5096 WP_003419762.1.50981 WP_003419762.1.50987 WP_003419762.1.51009 WP_003419762.1.51037 WP_003419762.1.51074 WP_003419762.1.51082 WP_003419762.1.51101 WP_003419762.1.51116 WP_003419762.1.51149 WP_003419762.1.51156 WP_003419762.1.51157 WP_003419762.1.51213 WP_003419762.1.51232 WP_003419762.1.51239 WP_003419762.1.51247 WP_003419762.1.51266 WP_003419762.1.51279 WP_003419762.1.51291 WP_003419762.1.51294 WP_003419762.1.51301 WP_003419762.1.51329 WP_003419762.1.51391 WP_003419762.1.51422 WP_003419762.1.51445 WP_003419762.1.51455 WP_003419762.1.51466 WP_003419762.1.51468 WP_003419762.1.51478 WP_003419762.1.51497 WP_003419762.1.51520 WP_003419762.1.51593 WP_003419762.1.51628 WP_003419762.1.5164 WP_003419762.1.51647 WP_003419762.1.51660 WP_003419762.1.51696 WP_003419762.1.51721 WP_003419762.1.51788 WP_003419762.1.51795 WP_003419762.1.51801 WP_003419762.1.51817 WP_003419762.1.51819 WP_003419762.1.51854 WP_003419762.1.51923 WP_003419762.1.51942 WP_003419762.1.51948 WP_003419762.1.51963 WP_003419762.1.51969 WP_003419762.1.52000 WP_003419762.1.52001 WP_003419762.1.52003 WP_003419762.1.52006 WP_003419762.1.52036 WP_003419762.1.52038 WP_003419762.1.52046 WP_003419762.1.52059 WP_003419762.1.52069 WP_003419762.1.52082 WP_003419762.1.52102 WP_003419762.1.52106 WP_003419762.1.52166 WP_003419762.1.52168 WP_003419762.1.52173 WP_003419762.1.52178 WP_003419762.1.52206 WP_003419762.1.52216 WP_003419762.1.52238 WP_003419762.1.52241 WP_003419762.1.52280 WP_003419762.1.52314 WP_003419762.1.52385 WP_003419762.1.52390 WP_003419762.1.524 WP_003419762.1.52460 WP_003419762.1.52485 WP_003419762.1.52486 WP_003419762.1.52495 WP_003419762.1.52504 WP_003419762.1.52522 WP_003419762.1.52531 WP_003419762.1.52533 WP_003419762.1.52545 WP_003419762.1.52553 WP_003419762.1.52563 WP_003419762.1.52564 WP_003419762.1.52574 WP_003419762.1.52641 WP_003419762.1.52673 WP_003419762.1.52674 WP_003419762.1.52708 WP_003419762.1.52713 WP_003419762.1.52761 WP_003419762.1.52778 WP_003419762.1.52791 WP_003419762.1.52797 WP_003419762.1.52818 WP_003419762.1.52872 WP_003419762.1.52873 WP_003419762.1.52891 WP_003419762.1.52892 WP_003419762.1.52909 WP_003419762.1.52970 WP_003419762.1.52998 WP_003419762.1.53053 WP_003419762.1.53056 WP_003419762.1.5306 WP_003419762.1.53088 WP_003419762.1.5309 WP_003419762.1.531 WP_003419762.1.53117 WP_003419762.1.53118 WP_003419762.1.53142 WP_003419762.1.53143 WP_003419762.1.53157 WP_003419762.1.53167 WP_003419762.1.53200 WP_003419762.1.53204 WP_003419762.1.53213 WP_003419762.1.53217 WP_003419762.1.53226 WP_003419762.1.53229 WP_003419762.1.53230 WP_003419762.1.53237 WP_003419762.1.53254 WP_003419762.1.53257 WP_003419762.1.5327 WP_003419762.1.53276 WP_003419762.1.53278 WP_003419762.1.533 WP_003419762.1.53302 WP_003419762.1.53306 WP_003419762.1.5334 WP_003419762.1.5335 WP_003419762.1.53353 WP_003419762.1.53381 WP_003419762.1.53413 WP_003419762.1.53458 WP_003419762.1.53460 WP_003419762.1.53480 WP_003419762.1.53517 WP_003419762.1.53522 WP_003419762.1.53525 WP_003419762.1.53526 WP_003419762.1.53553 WP_003419762.1.53606 WP_003419762.1.53609 WP_003419762.1.53628 WP_003419762.1.53643 WP_003419762.1.53667 WP_003419762.1.53679 WP_003419762.1.53715 WP_003419762.1.53730 WP_003419762.1.53742 WP_003419762.1.53743 WP_003419762.1.53754 WP_003419762.1.53775 WP_003419762.1.53787 WP_003419762.1.53803 WP_003419762.1.53818 WP_003419762.1.53822 WP_003419762.1.53853 WP_003419762.1.53865 WP_003419762.1.53888 WP_003419762.1.53900 WP_003419762.1.53912 WP_003419762.1.53914 WP_003419762.1.53952 WP_003419762.1.53973 WP_003419762.1.5398 WP_003419762.1.5408 WP_003419762.1.54089 WP_003419762.1.54093 WP_003419762.1.54099 WP_003419762.1.54112 WP_003419762.1.54125 WP_003419762.1.54141 WP_003419762.1.54162 WP_003419762.1.54179 WP_003419762.1.54206 WP_003419762.1.54218 WP_003419762.1.54225 WP_003419762.1.54227 WP_003419762.1.54232 WP_003419762.1.54241 WP_003419762.1.54245 WP_003419762.1.54247 WP_003419762.1.54260 WP_003419762.1.54275 WP_003419762.1.54280 WP_003419762.1.5429 WP_003419762.1.54294 WP_003419762.1.54314 WP_003419762.1.54347 WP_003419762.1.54351 WP_003419762.1.54370 WP_003419762.1.54428 WP_003419762.1.54449 WP_003419762.1.54494 WP_003419762.1.54514 WP_003419762.1.54519 WP_003419762.1.5452 WP_003419762.1.54531 WP_003419762.1.54537 WP_003419762.1.54553 WP_003419762.1.54555 WP_003419762.1.54575 WP_003419762.1.54633 WP_003419762.1.54686 WP_003419762.1.54687 WP_003419762.1.54705 WP_003419762.1.54730 WP_003419762.1.54732 WP_003419762.1.5475 WP_003419762.1.54797 WP_003419762.1.54807 WP_003419762.1.54836 WP_003419762.1.54838 WP_003419762.1.54860 WP_003419762.1.54888 WP_003419762.1.54897 WP_003419762.1.54905 WP_003419762.1.54909 WP_003419762.1.54937 WP_003419762.1.54939 WP_003419762.1.54944 WP_003419762.1.54945 WP_003419762.1.54953 WP_003419762.1.54964 WP_003419762.1.55015 WP_003419762.1.55022 WP_003419762.1.55023 WP_003419762.1.55051 WP_003419762.1.55072 WP_003419762.1.55088 WP_003419762.1.55106 WP_003419762.1.55126 WP_003419762.1.55128 WP_003419762.1.55140 WP_003419762.1.55150 WP_003419762.1.55210 WP_003419762.1.55227 WP_003419762.1.55248 WP_003419762.1.55257 WP_003419762.1.55258 WP_003419762.1.55267 WP_003419762.1.55279 WP_003419762.1.55307 WP_003419762.1.55326 WP_003419762.1.55328 WP_003419762.1.5533 WP_003419762.1.55345 WP_003419762.1.55396 WP_003419762.1.55398 WP_003419762.1.55441 WP_003419762.1.55459 WP_003419762.1.55501 WP_003419762.1.55504 WP_003419762.1.55578 WP_003419762.1.55626 WP_003419762.1.55641 WP_003419762.1.5569 WP_003419762.1.55723 WP_003419762.1.55735 WP_003419762.1.5574 WP_003419762.1.55772 WP_003419762.1.55802 WP_003419762.1.55807 WP_003419762.1.55819 WP_003419762.1.55821 WP_003419762.1.5583 WP_003419762.1.55849 WP_003419762.1.55856 WP_003419762.1.55860 WP_003419762.1.55882 WP_003419762.1.55883 WP_003419762.1.55894 WP_003419762.1.55902 WP_003419762.1.55908 WP_003419762.1.55909 WP_003419762.1.5591 WP_003419762.1.55961 WP_003419762.1.55977 WP_003419762.1.55983 WP_003419762.1.56028 WP_003419762.1.56057 WP_003419762.1.56060 WP_003419762.1.56107 WP_003419762.1.56132 WP_003419762.1.56163 WP_003419762.1.56167 WP_003419762.1.56178 WP_003419762.1.56287 WP_003419762.1.56292 WP_003419762.1.56327 WP_003419762.1.56341 WP_003419762.1.56359 WP_003419762.1.56365 WP_003419762.1.56394 WP_003419762.1.56443 WP_003419762.1.56473 WP_003419762.1.56478 WP_003419762.1.56500 WP_003419762.1.56517 WP_003419762.1.56534 WP_003419762.1.5656 WP_003419762.1.56577 WP_003419762.1.56593 WP_003419762.1.56625 WP_003419762.1.56637 WP_003419762.1.56670 WP_003419762.1.56697 WP_003419762.1.567 WP_003419762.1.56701 WP_003419762.1.56709 WP_003419762.1.56743 WP_003419762.1.56755 WP_003419762.1.56764 WP_003419762.1.56769 WP_003419762.1.56770 WP_003419762.1.56795 WP_003419762.1.5681 WP_003419762.1.56827 WP_003419762.1.56839 WP_003419762.1.56863 WP_003419762.1.56868 WP_003419762.1.56869 WP_003419762.1.56915 WP_003419762.1.56926 WP_003419762.1.56961 WP_003419762.1.56971 WP_003419762.1.56972 WP_003419762.1.57023 WP_003419762.1.57035 WP_003419762.1.57077 WP_003419762.1.57087 WP_003419762.1.57094 WP_003419762.1.57134 WP_003419762.1.57151 WP_003419762.1.57169 WP_003419762.1.57208 WP_003419762.1.57212 WP_003419762.1.57230 WP_003419762.1.5724 WP_003419762.1.5725 WP_003419762.1.5727 WP_003419762.1.57273 WP_003419762.1.573 WP_003419762.1.57314 WP_003419762.1.57326 WP_003419762.1.57328 WP_003419762.1.57331 WP_003419762.1.57340 WP_003419762.1.57351 WP_003419762.1.57352 WP_003419762.1.57380 WP_003419762.1.57430 WP_003419762.1.5744 WP_003419762.1.57440 WP_003419762.1.5745 WP_003419762.1.57461 WP_003419762.1.57469 WP_003419762.1.57489 WP_003419762.1.575 WP_003419762.1.57509 WP_003419762.1.57519 WP_003419762.1.57525 WP_003419762.1.57551 WP_003419762.1.5758 WP_003419762.1.57596 WP_003419762.1.57604 WP_003419762.1.57617 WP_003419762.1.57619 WP_003419762.1.57627 WP_003419762.1.57642 WP_003419762.1.57658 WP_003419762.1.57667 WP_003419762.1.57675 WP_003419762.1.57689 WP_003419762.1.57708 WP_003419762.1.57794 WP_003419762.1.57821 WP_003419762.1.57825 WP_003419762.1.57843 WP_003419762.1.57906 WP_003419762.1.57924 WP_003419762.1.57926 WP_003419762.1.57930 WP_003419762.1.57957 WP_003419762.1.57960 WP_003419762.1.57964 WP_003419762.1.57991 WP_003419762.1.58086 WP_003419762.1.58103 WP_003419762.1.58108 WP_003419762.1.5811 WP_003419762.1.58121 WP_003419762.1.58145 WP_003419762.1.58164 WP_003419762.1.58174 WP_003419762.1.582 WP_003419762.1.58202 WP_003419762.1.58209 WP_003419762.1.58215 WP_003419762.1.5824 WP_003419762.1.58250 WP_003419762.1.58259 WP_003419762.1.58283 WP_003419762.1.58288 WP_003419762.1.5830 WP_003419762.1.58303 WP_003419762.1.58311 WP_003419762.1.58330 WP_003419762.1.58359 WP_003419762.1.58386 WP_003419762.1.58393 WP_003419762.1.58431 WP_003419762.1.5844 WP_003419762.1.58457 WP_003419762.1.58488 WP_003419762.1.58518 WP_003419762.1.58534 WP_003419762.1.58559 WP_003419762.1.58567 WP_003419762.1.58573 WP_003419762.1.58602 WP_003419762.1.58612 WP_003419762.1.58619 WP_003419762.1.58630 WP_003419762.1.5865 WP_003419762.1.58671 WP_003419762.1.58690 WP_003419762.1.58702 WP_003419762.1.58743 WP_003419762.1.58754 WP_003419762.1.5879 WP_003419762.1.5881 WP_003419762.1.58824 WP_003419762.1.58848 WP_003419762.1.58857 WP_003419762.1.58891 WP_003419762.1.58892 WP_003419762.1.5890 WP_003419762.1.58904 WP_003419762.1.58921 WP_003419762.1.58930 WP_003419762.1.58939 WP_003419762.1.58941 WP_003419762.1.58953 WP_003419762.1.58961 WP_003419762.1.5898 WP_003419762.1.59025 WP_003419762.1.59029 WP_003419762.1.59037 WP_003419762.1.59044 WP_003419762.1.59085 WP_003419762.1.59088 WP_003419762.1.59112 WP_003419762.1.59130 WP_003419762.1.5914 WP_003419762.1.59147 WP_003419762.1.59166 WP_003419762.1.59205 WP_003419762.1.59209 WP_003419762.1.59237 WP_003419762.1.59240 WP_003419762.1.59253 WP_003419762.1.59254 WP_003419762.1.59262 WP_003419762.1.59270 WP_003419762.1.5928 WP_003419762.1.59304 WP_003419762.1.59305 WP_003419762.1.59309 WP_003419762.1.59316 WP_003419762.1.59326 WP_003419762.1.59328 WP_003419762.1.59333 WP_003419762.1.59338 WP_003419762.1.59388 WP_003419762.1.59428 WP_003419762.1.59487 WP_003419762.1.59537 WP_003419762.1.59561 WP_003419762.1.59677 WP_003419762.1.59722 WP_003419762.1.59727 WP_003419762.1.59732 WP_003419762.1.59738 WP_003419762.1.59750 WP_003419762.1.59757 WP_003419762.1.59761 WP_003419762.1.59808 WP_003419762.1.59850 WP_003419762.1.59856 WP_003419762.1.59860 WP_003419762.1.59861 WP_003419762.1.5987 WP_003419762.1.59878 WP_003419762.1.59888 WP_003419762.1.59952 WP_003419762.1.5996 WP_003419762.1.59961 WP_003419762.1.59974 WP_003419762.1.6000 WP_003419762.1.60007 WP_003419762.1.60016 WP_003419762.1.6003 WP_003419762.1.60047 WP_003419762.1.6007 WP_003419762.1.60091 WP_003419762.1.60121 WP_003419762.1.60125 WP_003419762.1.60135 WP_003419762.1.60139 WP_003419762.1.60152 WP_003419762.1.60171 WP_003419762.1.60197 WP_003419762.1.6020 WP_003419762.1.60205 WP_003419762.1.60207 WP_003419762.1.60215 WP_003419762.1.60217 WP_003419762.1.60267 WP_003419762.1.60288 WP_003419762.1.60291 WP_003419762.1.60301 WP_003419762.1.60305 WP_003419762.1.60312 WP_003419762.1.60313 WP_003419762.1.60314 WP_003419762.1.60367 WP_003419762.1.60376 WP_003419762.1.60403 WP_003419762.1.60413 WP_003419762.1.60421 WP_003419762.1.60451 WP_003419762.1.60460 WP_003419762.1.60479 WP_003419762.1.60487 WP_003419762.1.60512 WP_003419762.1.60573 WP_003419762.1.60583 WP_003419762.1.60632 WP_003419762.1.60657 WP_003419762.1.60687 WP_003419762.1.60689 WP_003419762.1.60727 WP_003419762.1.60738 WP_003419762.1.60763 WP_003419762.1.6077 WP_003419762.1.60791 WP_003419762.1.60834 WP_003419762.1.60870 WP_003419762.1.60878 WP_003419762.1.60879 WP_003419762.1.60913 WP_003419762.1.60978 WP_003419762.1.61000 WP_003419762.1.61001 WP_003419762.1.61012 WP_003419762.1.61014 WP_003419762.1.61015 WP_003419762.1.61037 WP_003419762.1.61052 WP_003419762.1.61065 WP_003419762.1.61100 WP_003419762.1.61101 WP_003419762.1.61138 WP_003419762.1.61142 WP_003419762.1.61198 WP_003419762.1.612 WP_003419762.1.61234 WP_003419762.1.61281 WP_003419762.1.61314 WP_003419762.1.61321 WP_003419762.1.61326 WP_003419762.1.61328 WP_003419762.1.61368 WP_003419762.1.61391 WP_003419762.1.61406 WP_003419762.1.61409 WP_003419762.1.61420 WP_003419762.1.61422 WP_003419762.1.61425 WP_003419762.1.61428 WP_003419762.1.61469 WP_003419762.1.61494 WP_003419762.1.61522 WP_003419762.1.61552 WP_003419762.1.61557 WP_003419762.1.61567 WP_003419762.1.61571 WP_003419762.1.61573 WP_003419762.1.61584 WP_003419762.1.61586 WP_003419762.1.6159 WP_003419762.1.61592 WP_003419762.1.6160 WP_003419762.1.61614 WP_003419762.1.6163 WP_003419762.1.61655 WP_003419762.1.61665 WP_003419762.1.61669 WP_003419762.1.61682 WP_003419762.1.61692 WP_003419762.1.61719 WP_003419762.1.61728 WP_003419762.1.61750 WP_003419762.1.61754 WP_003419762.1.61755 WP_003419762.1.61757 WP_003419762.1.6179 WP_003419762.1.61793 WP_003419762.1.61816 WP_003419762.1.61842 WP_003419762.1.61850 WP_003419762.1.61862 WP_003419762.1.61865 WP_003419762.1.61868 WP_003419762.1.61911 WP_003419762.1.61925 WP_003419762.1.61941 WP_003419762.1.61953 WP_003419762.1.61986 WP_003419762.1.61987 WP_003419762.1.61998 WP_003419762.1.62021 WP_003419762.1.62087 WP_003419762.1.62089 WP_003419762.1.62101 WP_003419762.1.62104 WP_003419762.1.6211 WP_003419762.1.62132 WP_003419762.1.62162 WP_003419762.1.62225 WP_003419762.1.62230 WP_003419762.1.62238 WP_003419762.1.62249 WP_003419762.1.62270 WP_003419762.1.62281 WP_003419762.1.62307 WP_003419762.1.6231 WP_003419762.1.62359 WP_003419762.1.62371 WP_003419762.1.62379 WP_003419762.1.62395 WP_003419762.1.62408 WP_003419762.1.62449 WP_003419762.1.62468 WP_003419762.1.6248 WP_003419762.1.62508 WP_003419762.1.62565 WP_003419762.1.62594 WP_003419762.1.62606 WP_003419762.1.62616 WP_003419762.1.62666 WP_003419762.1.62687 WP_003419762.1.62715 WP_003419762.1.62730 WP_003419762.1.62738 WP_003419762.1.62761 WP_003419762.1.62766 WP_003419762.1.62786 WP_003419762.1.62813 WP_003419762.1.62839 WP_003419762.1.62841 WP_003419762.1.62909 WP_003419762.1.62936 WP_003419762.1.6294 WP_003419762.1.6295 WP_003419762.1.62962 WP_003419762.1.63007 WP_003419762.1.63019 WP_003419762.1.63032 WP_003419762.1.63037 WP_003419762.1.63064 WP_003419762.1.63066 WP_003419762.1.63072 WP_003419762.1.6308 WP_003419762.1.63081 WP_003419762.1.63096 WP_003419762.1.63106 WP_003419762.1.6314 WP_003419762.1.63144 WP_003419762.1.63154 WP_003419762.1.63160 WP_003419762.1.63161 WP_003419762.1.63166 WP_003419762.1.63175 WP_003419762.1.63194 WP_003419762.1.6322 WP_003419762.1.63222 WP_003419762.1.63247 WP_003419762.1.6328 WP_003419762.1.63291 WP_003419762.1.63312 WP_003419762.1.63317 WP_003419762.1.63331 WP_003419762.1.63373 WP_003419762.1.63384 WP_003419762.1.63403 WP_003419762.1.63424 WP_003419762.1.63428 WP_003419762.1.6345 WP_003419762.1.63464 WP_003419762.1.63483 WP_003419762.1.63502 WP_003419762.1.63504 WP_003419762.1.63522 WP_003419762.1.63530 WP_003419762.1.63538 WP_003419762.1.63564 WP_003419762.1.63567 WP_003419762.1.63596 WP_003419762.1.63600 WP_003419762.1.63623 WP_003419762.1.63624 WP_003419762.1.63625 WP_003419762.1.63627 WP_003419762.1.63654 WP_003419762.1.63662 WP_003419762.1.63711 WP_003419762.1.63734 WP_003419762.1.63807 WP_003419762.1.63819 WP_003419762.1.63844 WP_003419762.1.63888 WP_003419762.1.63913 WP_003419762.1.63915 WP_003419762.1.63918 WP_003419762.1.63961 WP_003419762.1.63970 WP_003419762.1.64000 WP_003419762.1.64027 WP_003419762.1.64058 WP_003419762.1.64065 WP_003419762.1.6407 WP_003419762.1.64082 WP_003419762.1.64091 WP_003419762.1.64102 WP_003419762.1.64104 WP_003419762.1.64119 WP_003419762.1.64169 WP_003419762.1.64219 WP_003419762.1.6422 WP_003419762.1.64222 WP_003419762.1.64223 WP_003419762.1.64228 WP_003419762.1.64235 WP_003419762.1.64249 WP_003419762.1.6427 WP_003419762.1.64278 WP_003419762.1.64287 WP_003419762.1.64414 WP_003419762.1.64419 WP_003419762.1.6443 WP_003419762.1.64463 WP_003419762.1.64480 WP_003419762.1.64497 WP_003419762.1.64506 WP_003419762.1.64511 WP_003419762.1.64513 WP_003419762.1.64514 WP_003419762.1.64515 WP_003419762.1.64522 WP_003419762.1.64526 WP_003419762.1.64543 WP_003419762.1.6456 WP_003419762.1.64567 WP_003419762.1.64588 WP_003419762.1.64589 WP_003419762.1.64594 WP_003419762.1.64595 WP_003419762.1.64608 WP_003419762.1.64619 WP_003419762.1.64629 WP_003419762.1.6464 WP_003419762.1.64664 WP_003419762.1.64669 WP_003419762.1.64672 WP_003419762.1.64680 WP_003419762.1.64682 WP_003419762.1.64727 WP_003419762.1.64729 WP_003419762.1.64774 WP_003419762.1.64776 WP_003419762.1.64802 WP_003419762.1.64832 WP_003419762.1.6486 WP_003419762.1.64870 WP_003419762.1.64898 WP_003419762.1.64922 WP_003419762.1.64924 WP_003419762.1.6493 WP_003419762.1.64937 WP_003419762.1.64941 WP_003419762.1.64973 WP_003419762.1.65001 WP_003419762.1.65026 WP_003419762.1.65053 WP_003419762.1.65070 WP_003419762.1.65079 WP_003419762.1.65102 WP_003419762.1.65157 WP_003419762.1.65181 WP_003419762.1.65212 WP_003419762.1.65229 WP_003419762.1.6523 WP_003419762.1.65253 WP_003419762.1.65289 WP_003419762.1.65291 WP_003419762.1.65315 WP_003419762.1.65329 WP_003419762.1.65359 WP_003419762.1.6536 WP_003419762.1.65374 WP_003419762.1.65386 WP_003419762.1.65414 WP_003419762.1.65416 WP_003419762.1.65433 WP_003419762.1.65455 WP_003419762.1.65467 WP_003419762.1.65488 WP_003419762.1.65529 WP_003419762.1.65539 WP_003419762.1.65583 WP_003419762.1.65612 WP_003419762.1.65623 WP_003419762.1.65635 WP_003419762.1.65637 WP_003419762.1.65648 WP_003419762.1.65683 WP_003419762.1.65686 WP_003419762.1.65688 WP_003419762.1.65707 WP_003419762.1.65733 WP_003419762.1.65746 WP_003419762.1.65747 WP_003419762.1.65759 WP_003419762.1.65816 WP_003419762.1.65830 WP_003419762.1.65858 WP_003419762.1.65862 WP_003419762.1.65869 WP_003419762.1.65893 WP_003419762.1.65929 WP_003419762.1.65932 WP_003419762.1.65958 WP_003419762.1.65974 WP_003419762.1.66004 WP_003419762.1.6606 WP_003419762.1.66089 WP_003419762.1.66149 WP_003419762.1.66151 WP_003419762.1.66229 WP_003419762.1.66276 WP_003419762.1.66293 WP_003419762.1.66297 WP_003419762.1.66323 WP_003419762.1.66325 WP_003419762.1.6633 WP_003419762.1.66334 WP_003419762.1.66355 WP_003419762.1.66367 WP_003419762.1.66394 WP_003419762.1.66396 WP_003419762.1.66451 WP_003419762.1.66455 WP_003419762.1.66457 WP_003419762.1.66464 WP_003419762.1.66466 WP_003419762.1.66487 WP_003419762.1.66504 WP_003419762.1.66544 WP_003419762.1.66558 WP_003419762.1.66580 WP_003419762.1.66582 WP_003419762.1.66612 WP_003419762.1.66615 WP_003419762.1.66617 WP_003419762.1.66635 WP_003419762.1.66656 WP_003419762.1.66663 WP_003419762.1.66675 WP_003419762.1.66715 WP_003419762.1.66718 WP_003419762.1.66762 WP_003419762.1.66776 WP_003419762.1.66808 WP_003419762.1.66817 WP_003419762.1.66819 WP_003419762.1.66826 WP_003419762.1.66830 WP_003419762.1.66842 WP_003419762.1.66868 WP_003419762.1.66878 WP_003419762.1.66880 WP_003419762.1.66893 WP_003419762.1.66961 WP_003419762.1.67005 WP_003419762.1.6704 WP_003419762.1.67044 WP_003419762.1.67061 WP_003419762.1.67089 WP_003419762.1.67098 WP_003419762.1.67146 WP_003419762.1.67170 WP_003419762.1.67197 WP_003419762.1.67198 WP_003419762.1.6720 WP_003419762.1.67207 WP_003419762.1.67218 WP_003419762.1.67220 WP_003419762.1.67225 WP_003419762.1.67231 WP_003419762.1.6724 WP_003419762.1.67257 WP_003419762.1.67298 WP_003419762.1.67307 WP_003419762.1.67324 WP_003419762.1.67332 WP_003419762.1.67346 WP_003419762.1.67354 WP_003419762.1.67360 WP_003419762.1.67381 WP_003419762.1.67396 WP_003419762.1.67417 WP_003419762.1.67422 WP_003419762.1.67453 WP_003419762.1.67459 WP_003419762.1.6746 WP_003419762.1.67473 WP_003419762.1.67481 WP_003419762.1.67482 WP_003419762.1.67496 WP_003419762.1.67499 WP_003419762.1.67516 WP_003419762.1.67523 WP_003419762.1.67536 WP_003419762.1.67575 WP_003419762.1.67587 WP_003419762.1.67598 WP_003419762.1.67600 WP_003419762.1.67602 WP_003419762.1.67630 WP_003419762.1.67679 WP_003419762.1.67692 WP_003419762.1.67744 WP_003419762.1.6775 WP_003419762.1.67750 WP_003419762.1.6777 WP_003419762.1.67809 WP_003419762.1.67816 WP_003419762.1.67844 WP_003419762.1.67848 WP_003419762.1.67870 WP_003419762.1.67888 WP_003419762.1.67915 WP_003419762.1.67945 WP_003419762.1.67949 WP_003419762.1.67980 WP_003419762.1.67982 WP_003419762.1.68022 WP_003419762.1.68029 WP_003419762.1.68037 WP_003419762.1.68038 WP_003419762.1.68045 WP_003419762.1.68057 WP_003419762.1.68083 WP_003419762.1.68088 WP_003419762.1.68106 WP_003419762.1.68110 WP_003419762.1.68153 WP_003419762.1.68164 WP_003419762.1.68169 WP_003419762.1.68193 WP_003419762.1.68212 WP_003419762.1.68227 WP_003419762.1.68243 WP_003419762.1.6825 WP_003419762.1.68297 WP_003419762.1.68309 WP_003419762.1.68325 WP_003419762.1.68329 WP_003419762.1.68340 WP_003419762.1.68384 WP_003419762.1.68388 WP_003419762.1.68429 WP_003419762.1.6843 WP_003419762.1.68433 WP_003419762.1.68444 WP_003419762.1.68465 WP_003419762.1.68484 WP_003419762.1.68518 WP_003419762.1.68569 WP_003419762.1.68576 WP_003419762.1.68580 WP_003419762.1.68586 WP_003419762.1.68623 WP_003419762.1.68624 WP_003419762.1.68637 WP_003419762.1.68646 WP_003419762.1.68667 WP_003419762.1.68669 WP_003419762.1.68672 WP_003419762.1.68684 WP_003419762.1.68704 WP_003419762.1.68708 WP_003419762.1.6872 WP_003419762.1.68730 WP_003419762.1.68734 WP_003419762.1.68748 WP_003419762.1.68754 WP_003419762.1.6876 WP_003419762.1.68761 WP_003419762.1.68763 WP_003419762.1.68766 WP_003419762.1.68774 WP_003419762.1.68796 WP_003419762.1.68824 WP_003419762.1.68832 WP_003419762.1.68833 WP_003419762.1.68841 WP_003419762.1.68859 WP_003419762.1.68876 WP_003419762.1.68906 WP_003419762.1.68916 WP_003419762.1.68923 WP_003419762.1.68945 WP_003419762.1.6896 WP_003419762.1.68981 WP_003419762.1.68984 WP_003419762.1.68997 WP_003419762.1.69008 WP_003419762.1.69076 WP_003419762.1.69079 WP_003419762.1.6908 WP_003419762.1.69082 WP_003419762.1.69178 WP_003419762.1.69208 WP_003419762.1.69231 WP_003419762.1.69256 WP_003419762.1.69311 WP_003419762.1.69315 WP_003419762.1.69322 WP_003419762.1.69342 WP_003419762.1.6935 WP_003419762.1.6936 WP_003419762.1.69369 WP_003419762.1.69374 WP_003419762.1.69398 WP_003419762.1.69401 WP_003419762.1.69426 WP_003419762.1.69427 WP_003419762.1.69429 WP_003419762.1.6949 WP_003419762.1.6951 WP_003419762.1.69511 WP_003419762.1.69526 WP_003419762.1.69528 WP_003419762.1.69547 WP_003419762.1.69573 WP_003419762.1.69581 WP_003419762.1.6960 WP_003419762.1.69617 WP_003419762.1.69634 WP_003419762.1.69647 WP_003419762.1.69659 WP_003419762.1.69673 WP_003419762.1.69682 WP_003419762.1.69684 WP_003419762.1.69686 WP_003419762.1.69707 WP_003419762.1.69709 WP_003419762.1.69723 WP_003419762.1.69736 WP_003419762.1.69778 WP_003419762.1.69800 WP_003419762.1.69802 WP_003419762.1.69845 WP_003419762.1.69870 WP_003419762.1.69873 WP_003419762.1.69898 WP_003419762.1.69913 WP_003419762.1.69925 WP_003419762.1.69931 WP_003419762.1.69938 WP_003419762.1.69955 WP_003419762.1.69957 WP_003419762.1.69981 WP_003419762.1.69990 WP_003419762.1.70 WP_003419762.1.70000 WP_003419762.1.70017 WP_003419762.1.70032 WP_003419762.1.70055 WP_003419762.1.70062 WP_003419762.1.70072 WP_003419762.1.70131 WP_003419762.1.70132 WP_003419762.1.7022 WP_003419762.1.70227 WP_003419762.1.70255 WP_003419762.1.70271 WP_003419762.1.70274 WP_003419762.1.7029 WP_003419762.1.70325 WP_003419762.1.70328 WP_003419762.1.70356 WP_003419762.1.70364 WP_003419762.1.70368 WP_003419762.1.70369 WP_003419762.1.70418 WP_003419762.1.70422 WP_003419762.1.70435 WP_003419762.1.70444 WP_003419762.1.70463 WP_003419762.1.70471 WP_003419762.1.70480 WP_003419762.1.70494 WP_003419762.1.70498 WP_003419762.1.70505 WP_003419762.1.70525 WP_003419762.1.70573 WP_003419762.1.70577 WP_003419762.1.70610 WP_003419762.1.70615 WP_003419762.1.70618 WP_003419762.1.70622 WP_003419762.1.70626 WP_003419762.1.70668 WP_003419762.1.70699 WP_003419762.1.70704 WP_003419762.1.70729 WP_003419762.1.70757 WP_003419762.1.70782 WP_003419762.1.70796 WP_003419762.1.70830 WP_003419762.1.70834 WP_003419762.1.7084 WP_003419762.1.70840 WP_003419762.1.70864 WP_003419762.1.70871 WP_003419762.1.70915 WP_003419762.1.70955 WP_003419762.1.70958 WP_003419762.1.70964 WP_003419762.1.70976 WP_003419762.1.71015 WP_003419762.1.71026 WP_003419762.1.71063 WP_003419762.1.71076 WP_003419762.1.71083 WP_003419762.1.7111 WP_003419762.1.71118 WP_003419762.1.71128 WP_003419762.1.7113 WP_003419762.1.71187 WP_003419762.1.71191 WP_003419762.1.71258 WP_003419762.1.71259 WP_003419762.1.71289 WP_003419762.1.71326 WP_003419762.1.71329 WP_003419762.1.71331 WP_003419762.1.71344 WP_003419762.1.71390 WP_003419762.1.71399 WP_003419762.1.71414 WP_003419762.1.71440 WP_003419762.1.71457 WP_003419762.1.7146 WP_003419762.1.71464 WP_003419762.1.71490 WP_003419762.1.71492 WP_003419762.1.71509 WP_003419762.1.71516 WP_003419762.1.71517 WP_003419762.1.71527 WP_003419762.1.71532 WP_003419762.1.71545 WP_003419762.1.71546 WP_003419762.1.71569 WP_003419762.1.71604 WP_003419762.1.71630 WP_003419762.1.71638 WP_003419762.1.71654 WP_003419762.1.71664 WP_003419762.1.71665 WP_003419762.1.71683 WP_003419762.1.71701 WP_003419762.1.71718 WP_003419762.1.71731 WP_003419762.1.71778 WP_003419762.1.71781 WP_003419762.1.71803 WP_003419762.1.71847 WP_003419762.1.7185 WP_003419762.1.71851 WP_003419762.1.71871 WP_003419762.1.71909 WP_003419762.1.71957 WP_003419762.1.71970 WP_003419762.1.72047 WP_003419762.1.72061 WP_003419762.1.72062 WP_003419762.1.72072 WP_003419762.1.72111 WP_003419762.1.72122 WP_003419762.1.72128 WP_003419762.1.72143 WP_003419762.1.7216 WP_003419762.1.72168 WP_003419762.1.72179 WP_003419762.1.72209 WP_003419762.1.72227 WP_003419762.1.7224 WP_003419762.1.72268 WP_003419762.1.72332 WP_003419762.1.72380 WP_003419762.1.72401 WP_003419762.1.72405 WP_003419762.1.72420 WP_003419762.1.72441 WP_003419762.1.72451 WP_003419762.1.72452 WP_003419762.1.72457 WP_003419762.1.72459 WP_003419762.1.72460 WP_003419762.1.72466 WP_003419762.1.72487 WP_003419762.1.72488 WP_003419762.1.72492 WP_003419762.1.72506 WP_003419762.1.72543 WP_003419762.1.7256 WP_003419762.1.72576 WP_003419762.1.72578 WP_003419762.1.72585 WP_003419762.1.72591 WP_003419762.1.72592 WP_003419762.1.72640 WP_003419762.1.72661 WP_003419762.1.72684 WP_003419762.1.72739 WP_003419762.1.72744 WP_003419762.1.72755 WP_003419762.1.72759 WP_003419762.1.72784 WP_003419762.1.72792 WP_003419762.1.72826 WP_003419762.1.72831 WP_003419762.1.72852 WP_003419762.1.72853 WP_003419762.1.72879 WP_003419762.1.72880 WP_003419762.1.72938 WP_003419762.1.72954 WP_003419762.1.72957 WP_003419762.1.72959 WP_003419762.1.72973 WP_003419762.1.7298 WP_003419762.1.72982 WP_003419762.1.72988 WP_003419762.1.72993 WP_003419762.1.73006 WP_003419762.1.73013 WP_003419762.1.73025 WP_003419762.1.73028 WP_003419762.1.73042 WP_003419762.1.73045 WP_003419762.1.73092 WP_003419762.1.73118 WP_003419762.1.7312 WP_003419762.1.73127 WP_003419762.1.73134 WP_003419762.1.73150 WP_003419762.1.73154 WP_003419762.1.73163 WP_003419762.1.73182 WP_003419762.1.73205 WP_003419762.1.7321 WP_003419762.1.73310 WP_003419762.1.73315 WP_003419762.1.73365 WP_003419762.1.73391 WP_003419762.1.73404 WP_003419762.1.73424 WP_003419762.1.73436 WP_003419762.1.73445 WP_003419762.1.73453 WP_003419762.1.73465 WP_003419762.1.73466 WP_003419762.1.73470 WP_003419762.1.73471 WP_003419762.1.73478 WP_003419762.1.73482 WP_003419762.1.73507 WP_003419762.1.73532 WP_003419762.1.73550 WP_003419762.1.73564 WP_003419762.1.73623 WP_003419762.1.73629 WP_003419762.1.73644 WP_003419762.1.73661 WP_003419762.1.7368 WP_003419762.1.73688 WP_003419762.1.73723 WP_003419762.1.73744 WP_003419762.1.73750 WP_003419762.1.73760 WP_003419762.1.73774 WP_003419762.1.7379 WP_003419762.1.73813 WP_003419762.1.73840 WP_003419762.1.73876 WP_003419762.1.7389 WP_003419762.1.73986 WP_003419762.1.74016 WP_003419762.1.74039 WP_003419762.1.74083 WP_003419762.1.74101 WP_003419762.1.74107 WP_003419762.1.74120 WP_003419762.1.74129 WP_003419762.1.74144 WP_003419762.1.7417 WP_003419762.1.74190 WP_003419762.1.74210 WP_003419762.1.7423 WP_003419762.1.74259 WP_003419762.1.74262 WP_003419762.1.74269 WP_003419762.1.74282 WP_003419762.1.74291 WP_003419762.1.74296 WP_003419762.1.74304 WP_003419762.1.7432 WP_003419762.1.74347 WP_003419762.1.7436 WP_003419762.1.74378 WP_003419762.1.74382 WP_003419762.1.74395 WP_003419762.1.74400 WP_003419762.1.74401 WP_003419762.1.74432 WP_003419762.1.74442 WP_003419762.1.74487 WP_003419762.1.74499 WP_003419762.1.74504 WP_003419762.1.74511 WP_003419762.1.74523 WP_003419762.1.74525 WP_003419762.1.74551 WP_003419762.1.74555 WP_003419762.1.74628 WP_003419762.1.74641 WP_003419762.1.74653 WP_003419762.1.74660 WP_003419762.1.74683 WP_003419762.1.7469 WP_003419762.1.74725 WP_003419762.1.74760 WP_003419762.1.74786 WP_003419762.1.74809 WP_003419762.1.74820 WP_003419762.1.74870 WP_003419762.1.74881 WP_003419762.1.74888 WP_003419762.1.74952 WP_003419762.1.7496 WP_003419762.1.74988 WP_003419762.1.75043 WP_003419762.1.75045 WP_003419762.1.75055 WP_003419762.1.75078 WP_003419762.1.75081 WP_003419762.1.75120 WP_003419762.1.75163 WP_003419762.1.75188 WP_003419762.1.75200 WP_003419762.1.75202 WP_003419762.1.75234 WP_003419762.1.75239 WP_003419762.1.75250 WP_003419762.1.75263 WP_003419762.1.75281 WP_003419762.1.75342 WP_003419762.1.7535 WP_003419762.1.75376 WP_003419762.1.75391 WP_003419762.1.75395 WP_003419762.1.75441 WP_003419762.1.75510 WP_003419762.1.75581 WP_003419762.1.75598 WP_003419762.1.75635 WP_003419762.1.75645 WP_003419762.1.75665 WP_003419762.1.75671 WP_003419762.1.75741 WP_003419762.1.75749 WP_003419762.1.75772 WP_003419762.1.75774 WP_003419762.1.75811 WP_003419762.1.75833 WP_003419762.1.7585 WP_003419762.1.75864 WP_003419762.1.75868 WP_003419762.1.75878 WP_003419762.1.75927 WP_003419762.1.75946 WP_003419762.1.75968 WP_003419762.1.75974 WP_003419762.1.76016 WP_003419762.1.76032 WP_003419762.1.76037 WP_003419762.1.7604 WP_003419762.1.76045 WP_003419762.1.76052 WP_003419762.1.76058 WP_003419762.1.76064 WP_003419762.1.76110 WP_003419762.1.76126 WP_003419762.1.76133 WP_003419762.1.76138 WP_003419762.1.76157 WP_003419762.1.76172 WP_003419762.1.76177 WP_003419762.1.76183 WP_003419762.1.76209 WP_003419762.1.76239 WP_003419762.1.76272 WP_003419762.1.76277 WP_003419762.1.76280 WP_003419762.1.76281 WP_003419762.1.76291 WP_003419762.1.76297 WP_003419762.1.76379 WP_003419762.1.76403 WP_003419762.1.76413 WP_003419762.1.76414 WP_003419762.1.76427 WP_003419762.1.76436 WP_003419762.1.76442 WP_003419762.1.76443 WP_003419762.1.76456 WP_003419762.1.76521 WP_003419762.1.76533 WP_003419762.1.76616 WP_003419762.1.76625 WP_003419762.1.76629 WP_003419762.1.76635 WP_003419762.1.76638 WP_003419762.1.76639 WP_003419762.1.76640 WP_003419762.1.76644 WP_003419762.1.76677 WP_003419762.1.76678 WP_003419762.1.76679 WP_003419762.1.76734 WP_003419762.1.76744 WP_003419762.1.76750 WP_003419762.1.76754 WP_003419762.1.76757 WP_003419762.1.76781 WP_003419762.1.76818 WP_003419762.1.76824 WP_003419762.1.76835 WP_003419762.1.76873 WP_003419762.1.76888 WP_003419762.1.76900 WP_003419762.1.7691 WP_003419762.1.76947 WP_003419762.1.76954 WP_003419762.1.76955 WP_003419762.1.76963 WP_003419762.1.770 WP_003419762.1.77000 WP_003419762.1.77008 WP_003419762.1.77021 WP_003419762.1.77056 WP_003419762.1.77065 WP_003419762.1.77075 WP_003419762.1.77107 WP_003419762.1.77115 WP_003419762.1.77118 WP_003419762.1.77125 WP_003419762.1.77141 WP_003419762.1.77142 WP_003419762.1.77250 WP_003419762.1.77252 WP_003419762.1.77260 WP_003419762.1.77266 WP_003419762.1.77280 WP_003419762.1.77285 WP_003419762.1.77312 WP_003419762.1.77348 WP_003419762.1.77351 WP_003419762.1.77352 WP_003419762.1.77361 WP_003419762.1.774 WP_003419762.1.7740 WP_003419762.1.77404 WP_003419762.1.77425 WP_003419762.1.77463 WP_003419762.1.77474 WP_003419762.1.7748 WP_003419762.1.77484 WP_003419762.1.77491 WP_003419762.1.77499 WP_003419762.1.77510 WP_003419762.1.77530 WP_003419762.1.77554 WP_003419762.1.77559 WP_003419762.1.77599 WP_003419762.1.77605 WP_003419762.1.7762 WP_003419762.1.77627 WP_003419762.1.77649 WP_003419762.1.77654 WP_003419762.1.7766 WP_003419762.1.77667 WP_003419762.1.77704 WP_003419762.1.77706 WP_003419762.1.77726 WP_003419762.1.77774 WP_003419762.1.7778 WP_003419762.1.77790 WP_003419762.1.77809 WP_003419762.1.77820 WP_003419762.1.77843 WP_003419762.1.77855 WP_003419762.1.77865 WP_003419762.1.77868 WP_003419762.1.77890 WP_003419762.1.77909 WP_003419762.1.77911 WP_003419762.1.77931 WP_003419762.1.77984 WP_003419762.1.78020 WP_003419762.1.78024 WP_003419762.1.78075 WP_003419762.1.78084 WP_003419762.1.78086 WP_003419762.1.7809 WP_003419762.1.78098 WP_003419762.1.78105 WP_003419762.1.78113 WP_003419762.1.78136 WP_003419762.1.78162 WP_003419762.1.7817 WP_003419762.1.78200 WP_003419762.1.78216 WP_003419762.1.78236 WP_003419762.1.78238 WP_003419762.1.78322 WP_003419762.1.78338 WP_003419762.1.7836 WP_003419762.1.78360 WP_003419762.1.78386 WP_003419762.1.78435 WP_003419762.1.7844 WP_003419762.1.78459 WP_003419762.1.78488 WP_003419762.1.7849 WP_003419762.1.78499 WP_003419762.1.785 WP_003419762.1.78516 WP_003419762.1.78524 WP_003419762.1.78526 WP_003419762.1.78538 WP_003419762.1.78545 WP_003419762.1.78547 WP_003419762.1.78574 WP_003419762.1.78580 WP_003419762.1.7860 WP_003419762.1.78620 WP_003419762.1.78646 WP_003419762.1.78648 WP_003419762.1.78649 WP_003419762.1.78655 WP_003419762.1.78657 WP_003419762.1.78659 WP_003419762.1.7869 WP_003419762.1.78692 WP_003419762.1.78760 WP_003419762.1.78766 WP_003419762.1.78776 WP_003419762.1.78778 WP_003419762.1.78784 WP_003419762.1.78788 WP_003419762.1.78790 WP_003419762.1.78793 WP_003419762.1.78860 WP_003419762.1.7887 WP_003419762.1.78884 WP_003419762.1.78932 WP_003419762.1.78969 WP_003419762.1.78977 WP_003419762.1.78980 WP_003419762.1.79005 WP_003419762.1.79016 WP_003419762.1.79033 WP_003419762.1.79064 WP_003419762.1.79066 WP_003419762.1.79068 WP_003419762.1.79077 WP_003419762.1.79095 WP_003419762.1.79112 WP_003419762.1.79122 WP_003419762.1.79145 WP_003419762.1.79152 WP_003419762.1.79163 WP_003419762.1.79182 WP_003419762.1.79198 WP_003419762.1.79213 WP_003419762.1.79218 WP_003419762.1.79268 WP_003419762.1.79273 WP_003419762.1.79278 WP_003419762.1.79290 WP_003419762.1.79319 WP_003419762.1.79325 WP_003419762.1.79326 WP_003419762.1.7933 WP_003419762.1.79330 WP_003419762.1.79339 WP_003419762.1.79394 WP_003419762.1.79399 WP_003419762.1.79413 WP_003419762.1.79422 WP_003419762.1.79445 WP_003419762.1.79447 WP_003419762.1.79471 WP_003419762.1.79480 WP_003419762.1.79482 WP_003419762.1.79488 WP_003419762.1.79500 WP_003419762.1.79502 WP_003419762.1.79508 WP_003419762.1.79514 WP_003419762.1.79561 WP_003419762.1.79565 WP_003419762.1.79578 WP_003419762.1.79588 WP_003419762.1.79598 WP_003419762.1.79615 WP_003419762.1.79684 WP_003419762.1.79698 WP_003419762.1.797 WP_003419762.1.79744 WP_003419762.1.79784 WP_003419762.1.79802 WP_003419762.1.79806 WP_003419762.1.79819 WP_003419762.1.79826 WP_003419762.1.79828 WP_003419762.1.79851 WP_003419762.1.79853 WP_003419762.1.79863 WP_003419762.1.79881 WP_003419762.1.79885 WP_003419762.1.79898 WP_003419762.1.7990 WP_003419762.1.79900 WP_003419762.1.79913 WP_003419762.1.79918 WP_003419762.1.79947 WP_003419762.1.79948 WP_003419762.1.7995 WP_003419762.1.7997 WP_003419762.1.80004 WP_003419762.1.80015 WP_003419762.1.80022 WP_003419762.1.80030 WP_003419762.1.80054 WP_003419762.1.80084 WP_003419762.1.80099 WP_003419762.1.80129 WP_003419762.1.80177 WP_003419762.1.80234 WP_003419762.1.8026 WP_003419762.1.80275 WP_003419762.1.8029 WP_003419762.1.80299 WP_003419762.1.80300 WP_003419762.1.80304 WP_003419762.1.80326 WP_003419762.1.80351 WP_003419762.1.8037 WP_003419762.1.80370 WP_003419762.1.80387 WP_003419762.1.80399 WP_003419762.1.8044 WP_003419762.1.80451 WP_003419762.1.80458 WP_003419762.1.80461 WP_003419762.1.80490 WP_003419762.1.80503 WP_003419762.1.80507 WP_003419762.1.80552 WP_003419762.1.80576 WP_003419762.1.80588 WP_003419762.1.80599 WP_003419762.1.8060 WP_003419762.1.80624 WP_003419762.1.80636 WP_003419762.1.80669 WP_003419762.1.80673 WP_003419762.1.80711 WP_003419762.1.80714 WP_003419762.1.80743 WP_003419762.1.80784 WP_003419762.1.80815 WP_003419762.1.80853 WP_003419762.1.80918 WP_003419762.1.8093 WP_003419762.1.80967 WP_003419762.1.8097 WP_003419762.1.80988 WP_003419762.1.81007 WP_003419762.1.81013 WP_003419762.1.8105 WP_003419762.1.81059 WP_003419762.1.81063 WP_003419762.1.81066 WP_003419762.1.81075 WP_003419762.1.81091 WP_003419762.1.81119 WP_003419762.1.81125 WP_003419762.1.81136 WP_003419762.1.8114 WP_003419762.1.81189 WP_003419762.1.81192 WP_003419762.1.812 WP_003419762.1.81230 WP_003419762.1.81249 WP_003419762.1.81250 WP_003419762.1.81264 WP_003419762.1.8128 WP_003419762.1.81287 WP_003419762.1.81297 WP_003419762.1.8138 WP_003419762.1.81407 WP_003419762.1.8143 WP_003419762.1.81439 WP_003419762.1.81465 WP_003419762.1.81505 WP_003419762.1.81529 WP_003419762.1.81538 WP_003419762.1.81541 WP_003419762.1.81560 WP_003419762.1.81561 WP_003419762.1.81567 WP_003419762.1.81583 WP_003419762.1.81686 WP_003419762.1.81712 WP_003419762.1.81720 WP_003419762.1.81731 WP_003419762.1.81774 WP_003419762.1.81788 WP_003419762.1.81809 WP_003419762.1.81820 WP_003419762.1.81850 WP_003419762.1.81883 WP_003419762.1.81891 WP_003419762.1.81911 WP_003419762.1.81918 WP_003419762.1.82011 WP_003419762.1.82048 WP_003419762.1.82069 WP_003419762.1.82071 WP_003419762.1.82108 WP_003419762.1.82136 WP_003419762.1.82142 WP_003419762.1.8215 WP_003419762.1.82158 WP_003419762.1.8217 WP_003419762.1.82209 WP_003419762.1.82210 WP_003419762.1.82228 WP_003419762.1.82236 WP_003419762.1.82251 WP_003419762.1.82271 WP_003419762.1.82305 WP_003419762.1.82307 WP_003419762.1.82309 WP_003419762.1.82317 WP_003419762.1.8232 WP_003419762.1.82346 WP_003419762.1.82374 WP_003419762.1.82385 WP_003419762.1.82429 WP_003419762.1.82460 WP_003419762.1.82462 WP_003419762.1.82483 WP_003419762.1.82494 WP_003419762.1.82531 WP_003419762.1.82546 WP_003419762.1.82547 WP_003419762.1.82549 WP_003419762.1.82577 WP_003419762.1.82592 WP_003419762.1.82597 WP_003419762.1.82598 WP_003419762.1.82625 WP_003419762.1.82642 WP_003419762.1.82651 WP_003419762.1.82653 WP_003419762.1.82681 WP_003419762.1.82685 WP_003419762.1.8271 WP_003419762.1.82712 WP_003419762.1.8273 WP_003419762.1.82743 WP_003419762.1.82757 WP_003419762.1.82774 WP_003419762.1.82803 WP_003419762.1.82836 WP_003419762.1.82860 WP_003419762.1.82871 WP_003419762.1.82892 WP_003419762.1.82935 WP_003419762.1.82957 WP_003419762.1.82973 WP_003419762.1.82981 WP_003419762.1.82983 WP_003419762.1.83004 WP_003419762.1.83009 WP_003419762.1.83044 WP_003419762.1.83065 WP_003419762.1.83074 WP_003419762.1.83110 WP_003419762.1.83146 WP_003419762.1.83149 WP_003419762.1.83159 WP_003419762.1.8317 WP_003419762.1.83173 WP_003419762.1.83181 WP_003419762.1.83182 WP_003419762.1.83191 WP_003419762.1.83197 WP_003419762.1.83212 WP_003419762.1.8326 WP_003419762.1.83262 WP_003419762.1.83273 WP_003419762.1.83309 WP_003419762.1.83332 WP_003419762.1.83334 WP_003419762.1.83341 WP_003419762.1.83349 WP_003419762.1.8335 WP_003419762.1.83353 WP_003419762.1.83367 WP_003419762.1.83380 WP_003419762.1.83381 WP_003419762.1.83389 WP_003419762.1.83408 WP_003419762.1.83409 WP_003419762.1.83435 WP_003419762.1.83470 WP_003419762.1.83524 WP_003419762.1.83526 WP_003419762.1.8358 WP_003419762.1.83589 WP_003419762.1.83601 WP_003419762.1.83611 WP_003419762.1.83638 WP_003419762.1.83648 WP_003419762.1.83656 WP_003419762.1.83667 WP_003419762.1.83689 WP_003419762.1.83692 WP_003419762.1.83705 WP_003419762.1.83766 WP_003419762.1.83793 WP_003419762.1.83794 WP_003419762.1.83802 WP_003419762.1.83805 WP_003419762.1.83839 WP_003419762.1.83842 WP_003419762.1.83850 WP_003419762.1.83861 WP_003419762.1.83884 WP_003419762.1.83920 WP_003419762.1.83929 WP_003419762.1.83930 WP_003419762.1.83975 WP_003419762.1.83991 WP_003419762.1.8400 WP_003419762.1.84027 WP_003419762.1.8404 WP_003419762.1.84057 WP_003419762.1.84070 WP_003419762.1.8409 WP_003419762.1.84112 WP_003419762.1.84146 WP_003419762.1.8415 WP_003419762.1.84176 WP_003419762.1.84186 WP_003419762.1.84192 WP_003419762.1.84228 WP_003419762.1.8424 WP_003419762.1.84244 WP_003419762.1.84259 WP_003419762.1.8426 WP_003419762.1.84277 WP_003419762.1.84287 WP_003419762.1.8434 WP_003419762.1.84388 WP_003419762.1.84408 WP_003419762.1.84409 WP_003419762.1.84438 WP_003419762.1.84460 WP_003419762.1.84488 WP_003419762.1.84504 WP_003419762.1.84525 WP_003419762.1.84620 WP_003419762.1.84623 WP_003419762.1.84641 WP_003419762.1.84655 WP_003419762.1.84666 WP_003419762.1.84670 WP_003419762.1.84739 WP_003419762.1.84748 WP_003419762.1.84766 WP_003419762.1.84772 WP_003419762.1.84774 WP_003419762.1.848 WP_003419762.1.84812 WP_003419762.1.84836 WP_003419762.1.84839 WP_003419762.1.84846 WP_003419762.1.84873 WP_003419762.1.84968 WP_003419762.1.84973 WP_003419762.1.84981 WP_003419762.1.84985 WP_003419762.1.8503 WP_003419762.1.85038 WP_003419762.1.85041 WP_003419762.1.85043 WP_003419762.1.8505 WP_003419762.1.85074 WP_003419762.1.8509 WP_003419762.1.8512 WP_003419762.1.85148 WP_003419762.1.8518 WP_003419762.1.8522 WP_003419762.1.85242 WP_003419762.1.85276 WP_003419762.1.85281 WP_003419762.1.85284 WP_003419762.1.85314 WP_003419762.1.85319 WP_003419762.1.85330 WP_003419762.1.85341 WP_003419762.1.85346 WP_003419762.1.8535 WP_003419762.1.85363 WP_003419762.1.85371 WP_003419762.1.85377 WP_003419762.1.85387 WP_003419762.1.85399 WP_003419762.1.85458 WP_003419762.1.8546 WP_003419762.1.85464 WP_003419762.1.85478 WP_003419762.1.85480 WP_003419762.1.85488 WP_003419762.1.85495 WP_003419762.1.85551 WP_003419762.1.85557 WP_003419762.1.85577 WP_003419762.1.85597 WP_003419762.1.85599 WP_003419762.1.85610 WP_003419762.1.8563 WP_003419762.1.85648 WP_003419762.1.85679 WP_003419762.1.85704 WP_003419762.1.85717 WP_003419762.1.85727 WP_003419762.1.85737 WP_003419762.1.85763 WP_003419762.1.85808 WP_003419762.1.85819 WP_003419762.1.85820 WP_003419762.1.85823 WP_003419762.1.85832 WP_003419762.1.8586 WP_003419762.1.85872 WP_003419762.1.85894 WP_003419762.1.85909 WP_003419762.1.85913 WP_003419762.1.85953 WP_003419762.1.85986 WP_003419762.1.86000 WP_003419762.1.86024 WP_003419762.1.86025 WP_003419762.1.86032 WP_003419762.1.86048 WP_003419762.1.86052 WP_003419762.1.86067 WP_003419762.1.86103 WP_003419762.1.86122 WP_003419762.1.86124 WP_003419762.1.86160 WP_003419762.1.86164 WP_003419762.1.86168 WP_003419762.1.86190 WP_003419762.1.86204 WP_003419762.1.86208 WP_003419762.1.86235 WP_003419762.1.86249 WP_003419762.1.86260 WP_003419762.1.86290 WP_003419762.1.863 WP_003419762.1.86327 WP_003419762.1.86334 WP_003419762.1.86337 WP_003419762.1.86368 WP_003419762.1.86377 WP_003419762.1.86425 WP_003419762.1.86459 WP_003419762.1.8649 WP_003419762.1.86499 WP_003419762.1.86520 WP_003419762.1.86561 WP_003419762.1.86568 WP_003419762.1.86575 WP_003419762.1.86584 WP_003419762.1.86605 WP_003419762.1.86626 WP_003419762.1.86648 WP_003419762.1.8666 WP_003419762.1.86684 WP_003419762.1.86696 WP_003419762.1.86705 WP_003419762.1.86718 WP_003419762.1.86757 WP_003419762.1.86766 WP_003419762.1.86801 WP_003419762.1.86814 WP_003419762.1.86820 WP_003419762.1.86825 WP_003419762.1.86834 WP_003419762.1.8685 WP_003419762.1.86851 WP_003419762.1.86855 WP_003419762.1.86867 WP_003419762.1.86877 WP_003419762.1.86883 WP_003419762.1.8689 WP_003419762.1.86892 WP_003419762.1.86933 WP_003419762.1.86941 WP_003419762.1.86950 WP_003419762.1.86962 WP_003419762.1.86963 WP_003419762.1.86979 WP_003419762.1.8700 WP_003419762.1.87001 WP_003419762.1.87002 WP_003419762.1.87031 WP_003419762.1.87116 WP_003419762.1.87117 WP_003419762.1.8714 WP_003419762.1.87162 WP_003419762.1.87178 WP_003419762.1.87191 WP_003419762.1.87201 WP_003419762.1.87209 WP_003419762.1.87240 WP_003419762.1.87266 WP_003419762.1.87273 WP_003419762.1.87275 WP_003419762.1.8733 WP_003419762.1.87345 WP_003419762.1.87369 WP_003419762.1.8737 WP_003419762.1.87401 WP_003419762.1.87404 WP_003419762.1.87406 WP_003419762.1.87409 WP_003419762.1.87444 WP_003419762.1.87446 WP_003419762.1.87459 WP_003419762.1.87472 WP_003419762.1.87489 WP_003419762.1.87494 WP_003419762.1.87496 WP_003419762.1.87582 WP_003419762.1.87588 WP_003419762.1.87617 WP_003419762.1.87619 WP_003419762.1.87620 WP_003419762.1.87634 WP_003419762.1.87643 WP_003419762.1.8765 WP_003419762.1.87650 WP_003419762.1.87654 WP_003419762.1.87658 WP_003419762.1.87665 WP_003419762.1.87676 WP_003419762.1.87677 WP_003419762.1.87684 WP_003419762.1.87692 WP_003419762.1.87707 WP_003419762.1.87732 WP_003419762.1.87784 WP_003419762.1.87796 WP_003419762.1.87809 WP_003419762.1.87817 WP_003419762.1.87827 WP_003419762.1.87831 WP_003419762.1.87835 WP_003419762.1.87837 WP_003419762.1.87866 WP_003419762.1.8789 WP_003419762.1.87911 WP_003419762.1.87924 WP_003419762.1.87951 WP_003419762.1.87955 WP_003419762.1.87956 WP_003419762.1.87991 WP_003419762.1.88 WP_003419762.1.88002 WP_003419762.1.88037 WP_003419762.1.88039 WP_003419762.1.88072 WP_003419762.1.88077 WP_003419762.1.88121 WP_003419762.1.88180 WP_003419762.1.88191 WP_003419762.1.88205 WP_003419762.1.88217 WP_003419762.1.88219 WP_003419762.1.88245 WP_003419762.1.88253 WP_003419762.1.88294 WP_003419762.1.88315 WP_003419762.1.88316 WP_003419762.1.88320 WP_003419762.1.88338 WP_003419762.1.8840 WP_003419762.1.88437 WP_003419762.1.88453 WP_003419762.1.88469 WP_003419762.1.88489 WP_003419762.1.88507 WP_003419762.1.88521 WP_003419762.1.88530 WP_003419762.1.88537 WP_003419762.1.88541 WP_003419762.1.88592 WP_003419762.1.88616 WP_003419762.1.88618 WP_003419762.1.8862 WP_003419762.1.88625 WP_003419762.1.88632 WP_003419762.1.88634 WP_003419762.1.88649 WP_003419762.1.8870 WP_003419762.1.88737 WP_003419762.1.88756 WP_003419762.1.888 WP_003419762.1.88824 WP_003419762.1.88886 WP_003419762.1.88965 WP_003419762.1.88985 WP_003419762.1.8902 WP_003419762.1.89025 WP_003419762.1.89041 WP_003419762.1.89046 WP_003419762.1.89082 WP_003419762.1.89162 WP_003419762.1.89168 WP_003419762.1.8917 WP_003419762.1.89193 WP_003419762.1.89205 WP_003419762.1.89207 WP_003419762.1.89225 WP_003419762.1.8925 WP_003419762.1.89277 WP_003419762.1.89286 WP_003419762.1.89293 WP_003419762.1.89320 WP_003419762.1.8935 WP_003419762.1.89371 WP_003419762.1.89378 WP_003419762.1.89392 WP_003419762.1.89406 WP_003419762.1.89451 WP_003419762.1.89453 WP_003419762.1.89473 WP_003419762.1.89475 WP_003419762.1.89483 WP_003419762.1.895 WP_003419762.1.89513 WP_003419762.1.89517 WP_003419762.1.89522 WP_003419762.1.8954 WP_003419762.1.89543 WP_003419762.1.89567 WP_003419762.1.8957 WP_003419762.1.89572 WP_003419762.1.89589 WP_003419762.1.89607 WP_003419762.1.89613 WP_003419762.1.89625 WP_003419762.1.89648 WP_003419762.1.8967 WP_003419762.1.89670 WP_003419762.1.89676 WP_003419762.1.89729 WP_003419762.1.89739 WP_003419762.1.89762 WP_003419762.1.8977 WP_003419762.1.89808 WP_003419762.1.8982 WP_003419762.1.89829 WP_003419762.1.89831 WP_003419762.1.89844 WP_003419762.1.89849 WP_003419762.1.8989 WP_003419762.1.89901 WP_003419762.1.89903 WP_003419762.1.89909 WP_003419762.1.8992 WP_003419762.1.89922 WP_003419762.1.89926 WP_003419762.1.89963 WP_003419762.1.89971 WP_003419762.1.8998 WP_003419762.1.89987 WP_003419762.1.900 WP_003419762.1.90048 WP_003419762.1.9007 WP_003419762.1.90080 WP_003419762.1.90130 WP_003419762.1.90134 WP_003419762.1.90137 WP_003419762.1.90157 WP_003419762.1.90184 WP_003419762.1.90199 WP_003419762.1.90231 WP_003419762.1.90245 WP_003419762.1.90308 WP_003419762.1.90322 WP_003419762.1.90328 WP_003419762.1.90372 WP_003419762.1.90439 WP_003419762.1.90481 WP_003419762.1.90499 WP_003419762.1.9050 WP_003419762.1.90527 WP_003419762.1.90550 WP_003419762.1.90560 WP_003419762.1.90612 WP_003419762.1.90640 WP_003419762.1.90672 WP_003419762.1.90687 WP_003419762.1.90691 WP_003419762.1.90711 WP_003419762.1.90722 WP_003419762.1.90744 WP_003419762.1.9075 WP_003419762.1.90756 WP_003419762.1.90767 WP_003419762.1.90771 WP_003419762.1.90785 WP_003419762.1.90788 WP_003419762.1.90800 WP_003419762.1.90810 WP_003419762.1.90816 WP_003419762.1.90819 WP_003419762.1.9082 WP_003419762.1.90831 WP_003419762.1.90884 WP_003419762.1.90899 WP_003419762.1.90906 WP_003419762.1.90958 WP_003419762.1.90976 WP_003419762.1.90977 WP_003419762.1.90987 WP_003419762.1.9102 WP_003419762.1.91026 WP_003419762.1.91032 WP_003419762.1.91043 WP_003419762.1.91053 WP_003419762.1.91082 WP_003419762.1.91106 WP_003419762.1.91112 WP_003419762.1.91144 WP_003419762.1.91151 WP_003419762.1.91157 WP_003419762.1.91167 WP_003419762.1.91169 WP_003419762.1.91192 WP_003419762.1.91201 WP_003419762.1.91207 WP_003419762.1.91208 WP_003419762.1.91211 WP_003419762.1.91214 WP_003419762.1.91230 WP_003419762.1.91244 WP_003419762.1.91251 WP_003419762.1.91260 WP_003419762.1.91265 WP_003419762.1.91284 WP_003419762.1.91294 WP_003419762.1.91303 WP_003419762.1.91322 WP_003419762.1.91352 WP_003419762.1.91386 WP_003419762.1.9139 WP_003419762.1.91398 WP_003419762.1.91430 WP_003419762.1.91436 WP_003419762.1.91483 WP_003419762.1.91496 WP_003419762.1.91507 WP_003419762.1.91576 WP_003419762.1.91589 WP_003419762.1.91694 WP_003419762.1.91695 WP_003419762.1.91713 WP_003419762.1.91717 WP_003419762.1.91728 WP_003419762.1.91743 WP_003419762.1.91759 WP_003419762.1.91784 WP_003419762.1.91785 WP_003419762.1.91786 WP_003419762.1.91802 WP_003419762.1.91822 WP_003419762.1.91828 WP_003419762.1.9189 WP_003419762.1.91896 WP_003419762.1.9190 WP_003419762.1.91931 WP_003419762.1.91937 WP_003419762.1.91944 WP_003419762.1.91953 WP_003419762.1.91957 WP_003419762.1.91976 WP_003419762.1.91978 WP_003419762.1.92021 WP_003419762.1.92083 WP_003419762.1.92127 WP_003419762.1.92144 WP_003419762.1.92150 WP_003419762.1.92153 WP_003419762.1.92190 WP_003419762.1.92192 WP_003419762.1.92200 WP_003419762.1.92220 WP_003419762.1.92221 WP_003419762.1.92222 WP_003419762.1.92273 WP_003419762.1.92289 WP_003419762.1.9229 WP_003419762.1.92294 WP_003419762.1.92300 WP_003419762.1.92317 WP_003419762.1.92334 WP_003419762.1.92338 WP_003419762.1.92345 WP_003419762.1.92356 WP_003419762.1.92364 WP_003419762.1.92380 WP_003419762.1.92416 WP_003419762.1.92428 WP_003419762.1.92447 WP_003419762.1.92456 WP_003419762.1.92467 WP_003419762.1.92471 WP_003419762.1.92490 WP_003419762.1.92508 WP_003419762.1.9251 WP_003419762.1.92511 WP_003419762.1.92523 WP_003419762.1.92527 WP_003419762.1.92536 WP_003419762.1.92592 WP_003419762.1.92597 WP_003419762.1.92603 WP_003419762.1.92606 WP_003419762.1.92610 WP_003419762.1.92613 WP_003419762.1.9263 WP_003419762.1.9265 WP_003419762.1.92650 WP_003419762.1.92660 WP_003419762.1.92677 WP_003419762.1.92685 WP_003419762.1.92689 WP_003419762.1.92690 WP_003419762.1.92706 WP_003419762.1.92714 WP_003419762.1.92736 WP_003419762.1.9274 WP_003419762.1.92752 WP_003419762.1.92760 WP_003419762.1.92777 WP_003419762.1.92803 WP_003419762.1.92833 WP_003419762.1.92856 WP_003419762.1.92881 WP_003419762.1.92892 WP_003419762.1.92907 WP_003419762.1.92908 WP_003419762.1.9291 WP_003419762.1.92917 WP_003419762.1.92996 WP_003419762.1.93006 WP_003419762.1.93009 WP_003419762.1.93015 WP_003419762.1.93043 WP_003419762.1.9307 WP_003419762.1.93083 WP_003419762.1.93097 WP_003419762.1.93137 WP_003419762.1.93192 WP_003419762.1.93199 WP_003419762.1.93203 WP_003419762.1.93212 WP_003419762.1.93234 WP_003419762.1.93245 WP_003419762.1.93257 WP_003419762.1.93265 WP_003419762.1.93297 WP_003419762.1.93320 WP_003419762.1.93328 WP_003419762.1.93337 WP_003419762.1.93343 WP_003419762.1.93349 WP_003419762.1.93363 WP_003419762.1.93377 WP_003419762.1.9338 WP_003419762.1.93407 WP_003419762.1.93417 WP_003419762.1.93419 WP_003419762.1.93426 WP_003419762.1.9344 WP_003419762.1.93443 WP_003419762.1.93447 WP_003419762.1.93470 WP_003419762.1.93483 WP_003419762.1.93487 WP_003419762.1.93495 WP_003419762.1.93499 WP_003419762.1.93516 WP_003419762.1.93536 WP_003419762.1.93544 WP_003419762.1.93555 WP_003419762.1.93560 WP_003419762.1.93564 WP_003419762.1.9357 WP_003419762.1.93573 WP_003419762.1.93576 WP_003419762.1.93588 WP_003419762.1.9363 WP_003419762.1.93645 WP_003419762.1.93649 WP_003419762.1.93659 WP_003419762.1.93677 WP_003419762.1.9368 WP_003419762.1.93689 WP_003419762.1.93693 WP_003419762.1.93698 WP_003419762.1.93706 WP_003419762.1.9371 WP_003419762.1.93792 WP_003419762.1.93823 WP_003419762.1.93871 WP_003419762.1.9388 WP_003419762.1.93894 WP_003419762.1.93903 WP_003419762.1.93907 WP_003419762.1.93913 WP_003419762.1.93946 WP_003419762.1.93950 WP_003419762.1.93953 WP_003419762.1.93954 WP_003419762.1.93988 WP_003419762.1.9407 WP_003419762.1.94143 WP_003419762.1.94154 WP_003419762.1.94184 WP_003419762.1.94204 WP_003419762.1.94205 WP_003419762.1.94226 WP_003419762.1.94231 WP_003419762.1.94256 WP_003419762.1.94261 WP_003419762.1.94281 WP_003419762.1.94292 WP_003419762.1.94297 WP_003419762.1.9431 WP_003419762.1.94326 WP_003419762.1.94339 WP_003419762.1.94392 WP_003419762.1.94416 WP_003419762.1.94421 WP_003419762.1.94456 WP_003419762.1.94470 WP_003419762.1.94480 WP_003419762.1.94495 WP_003419762.1.94511 WP_003419762.1.94512 WP_003419762.1.94525 WP_003419762.1.94528 WP_003419762.1.94564 WP_003419762.1.946 WP_003419762.1.94602 WP_003419762.1.94623 WP_003419762.1.94629 WP_003419762.1.9465 WP_003419762.1.94673 WP_003419762.1.94714 WP_003419762.1.94730 WP_003419762.1.94736 WP_003419762.1.94776 WP_003419762.1.9478 WP_003419762.1.94834 WP_003419762.1.94852 WP_003419762.1.94872 WP_003419762.1.9488 WP_003419762.1.94902 WP_003419762.1.94916 WP_003419762.1.94979 WP_003419762.1.94994 WP_003419762.1.94996 WP_003419762.1.94998 WP_003419762.1.95007 WP_003419762.1.95010 WP_003419762.1.95015 WP_003419762.1.95034 WP_003419762.1.95068 WP_003419762.1.95081 WP_003419762.1.95082 WP_003419762.1.9509 WP_003419762.1.95096 WP_003419762.1.95112 WP_003419762.1.95138 WP_003419762.1.9514 WP_003419762.1.95179 WP_003419762.1.95188 WP_003419762.1.95190 WP_003419762.1.95234 WP_003419762.1.95241 WP_003419762.1.95245 WP_003419762.1.95257 WP_003419762.1.95279 WP_003419762.1.9531 WP_003419762.1.95335 WP_003419762.1.95344 WP_003419762.1.9535 WP_003419762.1.95370 WP_003419762.1.95392 WP_003419762.1.95416 WP_003419762.1.95417 WP_003419762.1.95454 WP_003419762.1.95455 WP_003419762.1.95491 WP_003419762.1.95497 WP_003419762.1.95508 WP_003419762.1.95509 WP_003419762.1.95529 WP_003419762.1.95556 WP_003419762.1.95557 WP_003419762.1.95565 WP_003419762.1.95578 WP_003419762.1.95580 WP_003419762.1.95585 WP_003419762.1.95643 WP_003419762.1.95679 WP_003419762.1.95685 WP_003419762.1.957 WP_003419762.1.95724 WP_003419762.1.95727 WP_003419762.1.95730 WP_003419762.1.95735 WP_003419762.1.95758 WP_003419762.1.95772 WP_003419762.1.95797 WP_003419762.1.95839 WP_003419762.1.9585 WP_003419762.1.9590 WP_003419762.1.95902 WP_003419762.1.95924 WP_003419762.1.95926 WP_003419762.1.95953 WP_003419762.1.95958 WP_003419762.1.95964 WP_003419762.1.95973 WP_003419762.1.96006 WP_003419762.1.9602 WP_003419762.1.96036 WP_003419762.1.96062 WP_003419762.1.96065 WP_003419762.1.96098 WP_003419762.1.96166 WP_003419762.1.96171 WP_003419762.1.96182 WP_003419762.1.96204 WP_003419762.1.96230 WP_003419762.1.96235 WP_003419762.1.96242 WP_003419762.1.96245 WP_003419762.1.96254 WP_003419762.1.96259 WP_003419762.1.96286 WP_003419762.1.96313 WP_003419762.1.96318 WP_003419762.1.96345 WP_003419762.1.96360 WP_003419762.1.96373 WP_003419762.1.96456 WP_003419762.1.96486 WP_003419762.1.96560 WP_003419762.1.96569 WP_003419762.1.96573 WP_003419762.1.96575 WP_003419762.1.96576 WP_003419762.1.96611 WP_003419762.1.96621 WP_003419762.1.9667 WP_003419762.1.96681 WP_003419762.1.96726 WP_003419762.1.96733 WP_003419762.1.96742 WP_003419762.1.96754 WP_003419762.1.9678 WP_003419762.1.96832 WP_003419762.1.9685 WP_003419762.1.97008 WP_003419762.1.97009 WP_003419762.1.97056 WP_003419762.1.97084 WP_003419762.1.97087 WP_003419762.1.97094 WP_003419762.1.97096 WP_003419762.1.97099 WP_003419762.1.97108 WP_003419762.1.97113 WP_003419762.1.97122 WP_003419762.1.97127 WP_003419762.1.97129 WP_003419762.1.97136 WP_003419762.1.9716 WP_003419762.1.97176 WP_003419762.1.97222 WP_003419762.1.97223 WP_003419762.1.97237 WP_003419762.1.97242 WP_003419762.1.97270 WP_003419762.1.97283 WP_003419762.1.97296 WP_003419762.1.97321 WP_003419762.1.97325 WP_003419762.1.97366 WP_003419762.1.97376 WP_003419762.1.97380 WP_003419762.1.9739 WP_003419762.1.97462 WP_003419762.1.97517 WP_003419762.1.97519 WP_003419762.1.97535 WP_003419762.1.97540 WP_003419762.1.97545 WP_003419762.1.97546 WP_003419762.1.97550 WP_003419762.1.97577 WP_003419762.1.97584 WP_003419762.1.9759 WP_003419762.1.97591 WP_003419762.1.97609 WP_003419762.1.97618 WP_003419762.1.9763 WP_003419762.1.97669 WP_003419762.1.97673 WP_003419762.1.97700 WP_003419762.1.97701 WP_003419762.1.9773 WP_003419762.1.97730 WP_003419762.1.97740 WP_003419762.1.97751 WP_003419762.1.97754 WP_003419762.1.97797 WP_003419762.1.9782 WP_003419762.1.9784 WP_003419762.1.97888 WP_003419762.1.9790 WP_003419762.1.9795 WP_003419762.1.97951 WP_003419762.1.97958 WP_003419762.1.97966 WP_003419762.1.97977 WP_003419762.1.97979 WP_003419762.1.97995 WP_003419762.1.98018 WP_003419762.1.98034 WP_003419762.1.98052 WP_003419762.1.98071 WP_003419762.1.98072 WP_003419762.1.98113 WP_003419762.1.98114 WP_003419762.1.98128 WP_003419762.1.98181 WP_003419762.1.98188 WP_003419762.1.98189 WP_003419762.1.98213 WP_003419762.1.98225 WP_003419762.1.98291 WP_003419762.1.98335 WP_003419762.1.98350 WP_003419762.1.98395 WP_003419762.1.98412 WP_003419762.1.98441 WP_003419762.1.98443 WP_003419762.1.98462 WP_003419762.1.9848 WP_003419762.1.98482 WP_003419762.1.98486 WP_003419762.1.98488 WP_003419762.1.98503 WP_003419762.1.98516 WP_003419762.1.98524 WP_003419762.1.98536 WP_003419762.1.98541 WP_003419762.1.98566 WP_003419762.1.98576 WP_003419762.1.98590 WP_003419762.1.98594 WP_003419762.1.98629 WP_003419762.1.98645 WP_003419762.1.98646 WP_003419762.1.98649 WP_003419762.1.98656 WP_003419762.1.9867 WP_003419762.1.98674 WP_003419762.1.98697 WP_003419762.1.98701 WP_003419762.1.98739 WP_003419762.1.98749 WP_003419762.1.98765 WP_003419762.1.98770 WP_003419762.1.98777 WP_003419762.1.98778 WP_003419762.1.98802 WP_003419762.1.98838 WP_003419762.1.98850 WP_003419762.1.98906 WP_003419762.1.98935 WP_003419762.1.98948 WP_003419762.1.98953 WP_003419762.1.98984 WP_003419762.1.99000 WP_003419762.1.99023 WP_003419762.1.99030 WP_003419762.1.99055 WP_003419762.1.99062 WP_003419762.1.99086 WP_003419762.1.99115 WP_003419762.1.99117 WP_003419762.1.99161 WP_003419762.1.99176 WP_003419762.1.99205 WP_003419762.1.99211 WP_003419762.1.99216 WP_003419762.1.99222 WP_003419762.1.99251 WP_003419762.1.99294 WP_003419762.1.99312 WP_003419762.1.99315 WP_003419762.1.99316 WP_003419762.1.99322 WP_003419762.1.99328 WP_003419762.1.99365 WP_003419762.1.99368 WP_003419762.1.99379 WP_003419762.1.99396 WP_003419762.1.99402 WP_003419762.1.99404 WP_003419762.1.99419 WP_003419762.1.99438 WP_003419762.1.99460 WP_003419762.1.99468 WP_003419762.1.99473 WP_003419762.1.99513 WP_003419762.1.99529 WP_003419762.1.99548 WP_003419762.1.99572 WP_003419762.1.99575 WP_003419762.1.99578 WP_003419762.1.99605 WP_003419762.1.99609 WP_003419762.1.99617 WP_003419762.1.99635 WP_003419762.1.99650 WP_003419762.1.99672 WP_003419762.1.99701 WP_003419762.1.99711 WP_003419762.1.99716 WP_003419762.1.99740 WP_003419762.1.99745 WP_003419762.1.99749 WP_003419762.1.9976 WP_003419762.1.99798 WP_003419762.1.99817 WP_003419762.1.99832 WP_003419762.1.99847 WP_003419762.1.99852 WP_003419762.1.99886 WP_003419762.1.99897 WP_003419762.1.99899 WP_003419762.1.99915 WP_003419762.1.9993 WP_003419762.1.99982 WP_003419762.1.99991 336982.TBFG_13718 419947.MRA_3722 478434.TBMG_03729 83331.MT3789 83332.Rv3687c gi|386000476|ref|YP_005918775.1| gi|506928293|ref|YP_008008743.1| gi|479057682|ref|YP_007353488.1| gi|148663550|ref|YP_001285073.1| gi|386006493|ref|YP_005924772.1| gi|392388278|ref|YP_005309907.1| gi|471339771|ref|YP_007612484.1| gi|479316693|ref|YP_007856745.1| gi|253800731|ref|YP_003033732.1| gi|525676097|ref|YP_008227772.1| gi|392434168|ref|YP_006475212.1| Rv3687c gi|433632781|ref|YP_007266409.1| gi|433643875|ref|YP_007289634.1| gi|506928293|ref|YP_008008743.1| gi|385992902|ref|YP_005911200.1| gi|433636793|ref|YP_007270420.1| gi|197737760|ref|YP_002159076.1| gi|494702140|ref|YP_007967622.1| gi|148824891|ref|YP_001289645.1| gi|340628660|ref|YP_004747112.1| gi|433628828|ref|YP_007262457.1| gi|494698086|ref|YP_007963589.1| gi|375297954|ref|YP_005102221.1| gi|15610823|ref|NP_218204.1| gi|383309409|ref|YP_005362220.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]