SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338187.VIBHAR_02233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338187.VIBHAR_02233
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.31e-20
Family Anti-sigma factor antagonist SpoIIaa 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338187.VIBHAR_02233
Sequence length 106
Comment (Vibrio harveyi ATCC BAA-1116)
Sequence
MELRKQETAPNTLTIEFFGDLDAKGCRQAQHQIDEVIHSDHHKEVEINLQHVQFLDSSGI
GAIVYLYKRLVERERSMIIENVSGQPLEIMSLLRINHAIPVNSKGH
Download sequence
Identical sequences A0A2I8VWH4 A7MVP5 L8XKE6
WP_005528376.1.100291 WP_005528376.1.11576 WP_005528376.1.20786 WP_005528376.1.30734 WP_005528376.1.61813 WP_005528376.1.89106 WP_005528376.1.92229 gi|156974516|ref|YP_001445423.1| 338187.VIBHAR_02233 gi|538262735|gb|AGU93936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]