SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338187.VIBHAR_03654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338187.VIBHAR_03654
Domain Number 1 Region: 13-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000186
Family Anti-sigma factor antagonist SpoIIaa 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338187.VIBHAR_03654
Sequence length 106
Comment (Vibrio harveyi ATCC BAA-1116)
Sequence
MAQSHSQWQLQADILKLTGALDRDSVPALWAVAQQWLPSQTELECSLEEIERIDSAGMVM
LIHLLEHAKKQNCHIMLSFVPAQLRTLFQLSNVESLVAKHIQNYQG
Download sequence
Identical sequences A7MSC9 L8X999
338187.VIBHAR_03654 gi|156975888|ref|YP_001446795.1| gi|538264075|gb|AGU95276.1| WP_005535405.1.100291 WP_005535405.1.11576 WP_005535405.1.20786 WP_005535405.1.30734 WP_005535405.1.61813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]