SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338187.VIBHAR_06173 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338187.VIBHAR_06173
Domain Number 1 Region: 8-214
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.53e-25
Family Clp protease, ClpP subunit 0.055
Further Details:      
 
Domain Number 2 Region: 386-449
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000497
Family NfeD domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338187.VIBHAR_06173
Sequence length 455
Comment (Vibrio harveyi ATCC BAA-1116)
Sequence
MKQIRLWLLPLLLFASQALASTVWVLPVKGAIGPALSDYLSREIEEAQQNGVELVILKMD
TPGGLDSSMRDIIHAITTSTVPIATWVGPSGSRAASAGTYILLASHVAAMAEATNLGAAT
PVALGGAPQQPSSDEGKDSTDSQPESTEKASDEVPAKTAMEKKVINDARAYIKGLARLHD
RNAEWAEKAVSMAASLDATEALELNVIDFIANSPEDLVSTINGIEVKLNGKPFKLALDNP
TWVERVPDWRAEMLAVITNPNVAYILMLIGIYGLLLEFYNPGIGLPGVLGGICLLLAMYA
LQMMPVNYVGLGLLLLGIALMIAEAFNPSFGILGLGGVVAFVLGSIFLMDSDIPGFQIAL
PLIFGIAIFSVGLIVITVGLLLKIRSKKATTGLENFPGKLAVVSDDFVDGTGRVQLDGAL
WQAKAEQKLKQGDHVTVVKIKGLTLTVKPSDRPKE
Download sequence
Identical sequences A7N2R1
gi|156977386|ref|YP_001448292.1| WP_012129663.1.100291 WP_012129663.1.11576 gi|538266177|gb|AGU97377.1| 338187.VIBHAR_06173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]