SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338187.VIBHAR_06642 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338187.VIBHAR_06642
Domain Number 1 Region: 125-220
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-19
Family Voltage-gated potassium channels 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338187.VIBHAR_06642
Sequence length 228
Comment (Vibrio harveyi ATCC BAA-1116)
Sequence
MVIGKKLKNINEENNFFYLTLALIGLLIGGAFVQVVGEGAMEHLLQGFTIITFIVCMASL
RFDKNWSRFLYTLLGTWVVVIVIKAVLGIKEMDVVMLALTFAFFFGTFKSIARQILFTGH
VNTNKVIGSVALFLLLGLMWAIAYLILLEFSPNSFTGMEAISWGQNFSNAAYFSFVTLTT
LGYGDISPLTPLAQVVVYLEAIVGVFYMAIVVSSLVSSNIEHQVNKNG
Download sequence
Identical sequences A0A1P8MJ04 A7N4D0
WP_005429340.1.100291 WP_005429340.1.11576 WP_005429340.1.12359 WP_005429340.1.16230 WP_005429340.1.19947 WP_005429340.1.32528 WP_005429340.1.34412 WP_005429340.1.50503 WP_005429340.1.53497 WP_005429340.1.57729 WP_005429340.1.5980 WP_005429340.1.61993 WP_005429340.1.78839 WP_005429340.1.79102 WP_005429340.1.89106 WP_005429340.1.90381 WP_005429340.1.92229 338187.VIBHAR_06642 gi|156977851|ref|YP_001448757.1| gi|538265971|gb|AGU97171.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]