SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338963.Pcar_0143 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  338963.Pcar_0143
Domain Number - Region: 143-190
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0458
Family NfeD domain-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338963.Pcar_0143
Sequence length 191
Comment (Pelobacter carbinolicus)
Sequence
MTNAFAGLNGFEIFFLLCAIIGSFFLVVRMVMQFVGADIDADTDFDVDIDADHVDSDVGF
KLLSLQSLTAFLMMFGLVGLALYRQNGVCFGGSIVGACLAGLISVWVIGRLFAWFDRLQS
SGTLQTSMAIGCKGSVYLTIPAGGTGRVTIDFHNHLREFDAVADDDGEISTGTPVEVVQV
NAHVLVVKPIG
Download sequence
Identical sequences Q3A888
gi|404491682|ref|YP_006715788.1| WP_011339795.1.20986 2005487104 338963.Pcar_0143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]