SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338963.Pcar_0648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338963.Pcar_0648
Domain Number 1 Region: 78-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000209
Family NfeD domain-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338963.Pcar_0648
Sequence length 150
Comment (Pelobacter carbinolicus)
Sequence
MTEILWWYWVVFGLVLVALELVIPSFTIIWFGLGACCVGLLMLPFPTLPLAGQLLLWGGF
STLWTVLWFRRFKPYMTDRTKAGMSKDAIIGETGIVIQAVQPPHVKGRIRFVVPLLGDEE
WPCICDEALKAGDEARVLDIEGHVLRVARK
Download sequence
Identical sequences Q3A6V0
WP_011340350.1.20986 gi|404492238|ref|YP_006716344.1| 338963.Pcar_0648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]