SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338963.Pcar_1959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338963.Pcar_1959
Domain Number 1 Region: 44-211
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.33e-30
Family Clp protease, ClpP subunit 0.016
Further Details:      
 
Domain Number 2 Region: 382-447
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000811
Family NfeD domain-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338963.Pcar_1959
Sequence length 470
Comment (Pelobacter carbinolicus)
Sequence
MVQIIDVRRFVDCLHGSCRALALLIAVGVFVGIFLLSSAESQGAVRIGAVRIAGPINPVV
AEFVTQELDRINREEAVAFLLEIDTPGGLDSAMRQIIKGMLGSQIPVIVFVSPSGARAAS
AGALIALAADFAVMAPGTNLGAAHPVAIGGGQKPPDDVMMNKVVEDAAAYARSLAARRGR
SEIWAEKMVRESASISAREALQHGVIDLIAEDRAELLKKLHGRSYRRAERSEVLLCMDAT
VDMASMGWRQKILNAISNPNVAYMLLMLGILGVFFEISQPGVLLPGVVGAMSLLLALFAF
QTLPVNYVGILLIVLAMVLFILEVKVTSFGMLTVGGMISMTLGSLMLFEHSEPFLRLSKV
VVACTVLVTSGFFLLVVYFVVRTQRRRFVSGREGMVGLVGEAVTEIHADGQVFVHGEYWK
AFSAEPIAAGAAIEVVRLADNMRLEVRSAGVGPHRLDSHSTSGSDKEDCT
Download sequence
Identical sequences Q3A357
338963.Pcar_1959 WP_011341706.1.20986 gi|404493598|ref|YP_006717704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]