SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338966.Ppro_1654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338966.Ppro_1654
Domain Number 1 Region: 139-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.9e-131
Family Enolase 0.00000000869
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.65e-56
Family Enolase N-terminal domain-like 0.00000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338966.Ppro_1654
Sequence length 429
Comment (Pelobacter propionicus DSM 2379)
Sequence
MSEIVDIYAREILDSRGNPTLEVDVFLESGAFGRAAVPSGASTGEREALELRDGDMARYL
GKGVLKAVDNVNNEIADELIGMDADDQVAIDNKMLELDGTEFKSKLGANATLGVSLAVAK
AAADEAGLSLHKYIGGAGARELPLPMMNILNGGAHADNNVDIQEFMIMPAGARCFAEALR
MGAEIFHALKSVLKGKGYNTSVGDEGGFAPNLKSNEEALQVIMEAIVKAGYKPGEDVLLA
LDVASSELFKDGIYTLENEQQKQKTAAQLIDFYEDLVNRYPIISIEDGMAENDWDGWKLL
TDRLGKRIQIVGDDLFVTNPRILKEGIQKGIANSILVKLNQIGTLTETLEAIEMAKRAGY
TTVISHRSGETEDTTLADLAVAVNAGQIKTGSLCRTDRVAKYNQLLRIEEELDDCALFRG
HDVFYNLKK
Download sequence
Identical sequences A1APJ8
gi|118580076|ref|YP_901326.1| WP_011735545.1.31684 338966.Ppro_1654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]