SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338966.Ppro_2323 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338966.Ppro_2323
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-39
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 338966.Ppro_2323
Sequence length 185
Comment (Pelobacter propionicus DSM 2379)
Sequence
MSRYELRFSGAGGQGLITAGIIMAKAASIYEGKQAVQSQSYGPEARGGAAKSEVIISGDS
IDYPKVTQCDALLALTQKACDRYAAEIKDGGILLVDSDLVKNLPEGNYRKIALPILNIAR
SDVGRAIVANIVALGAMVAITGVVSRENVEKAVLSSLPEPFLELNRKAFNKGFDRAREAY
EETTH
Download sequence
Identical sequences A1ARG0
gi|118580738|ref|YP_901988.1| 338966.Ppro_2323 WP_011736186.1.31684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]