SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338966.Ppro_3280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338966.Ppro_3280
Domain Number 1 Region: 457-570
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000157
Family Anti-sigma factor antagonist SpoIIaa 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338966.Ppro_3280
Sequence length 590
Comment (Pelobacter propionicus DSM 2379)
Sequence
MSLNAPETVATLIRSVRTVNVRRWLPGVAVLRRYDRHLLTRDLAAGVVLAALMAPVGIGY
AEAAGLPLICGLYATIVPMVAYALLGPSRILVLGPDSALAALVGATVIPLAAGDAGRAAL
LAALLALMSGVLCVLAGIARFGFITDLLSKPIRYGYMNGIALTLMLGQLPKILGFSVKGD
SFLSLAAGLTRGVRDRMVNPTACLVGLACLGIMFGAKRWSPRFPGVLAALIAATLAVTLL
PLAQVAVVGALPQGLPAFRIPVSSPAEWISLCAGALAIALVSIAEMSVLSRIYALRGGYY
VDDNQELVALGFANLACGLFQGFPVSCSASRTPVAESAGARTQMTGVVGALLIALLLLFT
PGLMRQLPTAALGAVVIFACSSMVEVSAVRRLYGVRRGEFYLSLVCFLGVVFLGVIQGIF
IAVGMALLAFIWRAWRPYCAVLGRIDGMKGYHDITRHPEARQIPGLVLFRWDAPLFFANA
EIFREQALRAVSCAPTPTRWIVVAAEPVTDIDITAADVLAELDDELERSGIELCFAQMKG
PVKDHLKRYGLFTQLGTKNFFPTIGQAVDRYVDTFHVDWIDWEDVDLPVA
Download sequence
Identical sequences A1AU52
338966.Ppro_3280 WP_011737090.1.31684 gi|118581680|ref|YP_902930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]