SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338969.Rfer_0900 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338969.Rfer_0900
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000647
Family Anti-sigma factor antagonist SpoIIaa 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338969.Rfer_0900
Sequence length 121
Comment (Rhodoferax ferrireducens T118)
Sequence
MTSETKPTNEPSVLRIEGELTIFRAAELKPLLLAEPMAQAIDLSGVTELDTAGVQLLMLA
KKMALATQRKLSLVAHSPAVIEVFELLNLAAYFGDPLVMTQRRGGAATSSTSNATGRSYE
S
Download sequence
Identical sequences Q220A5
WP_011463221.1.86502 gi|89899708|ref|YP_522179.1| 338969.Rfer_0900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]