SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338969.Rfer_0951 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338969.Rfer_0951
Domain Number 1 Region: 95-359
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.1e-78
Family D-glucarate dehydratase-like 0.0000667
Further Details:      
 
Domain Number 2 Region: 1-111
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.31e-30
Family Enolase N-terminal domain-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 338969.Rfer_0951
Sequence length 382
Comment (Rhodoferax ferrireducens T118)
Sequence
MKITKLTTYIVPPRWCFLKIETDEGVVGWGEPVVEGRAHSVAAAVEELSDYLIGKDPRNI
EDHWTVLYRGGFYRGGAIHMSALAGIDQALWDIKGKALGVSVSQLLGGPVRNSIRVYSWI
GGDRPADVAAAAKDAVARGFTAVKMNGTEELQFVDSYEKVEAALANVAAVRDAVGLHVGI
GVDFHGRVHKPMAKVLIKELDQYKLMFIEEPVLSENYEALKELAPLTNTPIALGERLYSR
WDFKRILSDGYIDVIQPDVSHAGGITETRKIATMAEAYDVAVALHCPLGPIALAACLQVD
AVSYNAFIQEQSLGIHYNQSNDLLDYLTQPEVFAYDKGYVTIPQGPGLGIEINEEYVKER
AAIGHRWRNPIWRHRDGSFAEW
Download sequence
Identical sequences Q21ZV7
WP_011463269.1.86502 gi|89899756|ref|YP_522227.1| 338969.Rfer_0951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]