SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338969.Rfer_3209 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  338969.Rfer_3209
Domain Number 1 Region: 14-236
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.12e-42
Family PFOR Pyr module 0.00025
Further Details:      
 
Domain Number 2 Region: 1138-1489
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.67e-42
Family PFOR PP module 0.00025
Further Details:      
 
Domain Number 3 Region: 545-754
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.23e-40
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00091
Further Details:      
 
Domain Number 4 Region: 358-491
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.75e-23
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0016
Further Details:      
 
Domain Number 5 Region: 838-873,949-997
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000126
Family Ferredoxin domains from multidomain proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338969.Rfer_3209
Sequence length 1663
Comment (Rhodoferax ferrireducens T118)
Sequence
MKTQIAKYPGIPNVIHGNGAVAYVMNHVCGGVIGYPITPSTEIAEIYEAFRAEGGINVWG
KHPFFFGPEGEHSAQSGALGAALTGGQFISNASSSQGILYALESHYVTVGKKVGGFVLQV
AARVVSKHSLNVMAGHDDVYALMSSGYTILFGANPQEAADLAAISYRVASLSLIPVANAM
DGFATSHMLCEALMPEPALLAEYLGDPAGRIKAPTLAQEMLYGAKGRVVQLQHYLARHQA
DLTDDSLSKLSSFLDANAAEVEQDNVGKLVAQTLGWLPEELQGQWQRQWVNAFEKGTRQL
VPALVDVNNPGLTGAVQNQADFQAGAVDHRTHFANAVPAFVRQAMDEYAALSGRQYAPVQ
TFMCDDADTVMVGLGSVTDDVEAVVSHLRGLGQKVGLIAIKLLQPFPEGQLIAALQGKKA
VTVLERSDQTALTSLVTQALFKARENAAQLRHPGIPALSASPLLTTAIFGLGGHDLQPRH
LIAAFKNMADGNTAPLIYLGSQFFSQTATPRVAELQARLKLAYPETELMALETEANPKLL
PDAGFRVRFHSVGGYGTIASGKLLTDILAGVLEMHSKSAPKYGSEKSGAPTNYYITLSPE
PVKITNAELEDVEVVIAPDHKVFSHTNPLLGLVAGGTFILQSNASAEEVWQELPVQARKT
IRERQINFFIVDAFAVAKKHAPTPELATRMMGIAFIGAVAGHVSQVAAGAAPEVILEKVR
QQIAKKFGGKGGAVMEGNMAVIREGIEATQKVDYALDAFARIDARPAPIAIHDVSLSASM
CQSAGSSGCAGMFDRGYYDDMVLDPFREGAIGEAPVLPGTGLFMPAGTASAKDKGLFRRS
VPEFKADLCTGCMECALVCPDGAIPNSVHDIHELLLTGIGQLDIPPVQRELMRGHVYALT
ASVREAYRQSREARPFHELVAEAATHLETENVTVLRNFSTLIDALALYPVARTRPFFDAM
EKAKPGSGALYGVTVDPWKCTGCLECVEVCGPGALVTREQDAALLQTLQQRFDFMSKTPN
TPARFVVDAIQPGGEIKRLLLDRANYYSTTGGHGACRGCGEVTATRLVMATSHALADRRQ
REHIRELENLIGRMRDKQVALADHDAERQQRLGALINTLEKRLYLYESGPTGNGPAGTVV
ANSTGCSSVYASTFPFNAFKDPWVNSLFQDAQPLAKGIFEGIAAQTVGDVRALRLARLEL
ADAYDAQVHDPALRMLSWEQFSVAELGLMPTVITIGGDGATYDIGFGALSRILMSGTPLK
VLVLNTGSYSNTGGQASTSSFLGQDSDLARFGSTATGKHESRKELGLIAAFHSNVFVCAT
STALQGHFLKNTMECLSYTDGPAVLDVYTPCQGEQGIGDGASSERSRLAVESRMSPVFVH
DPRRGSTLHDWFSLEGNPDPLQTWATTTLEYQDDEGQLKLMSMALTPAHFALGEVRFKKQ
FHKLGADDTLALPVEAYVELPRPERAGKTAFIWSTDANRRLIKIAVAEAIVALVEERRKY
WHLLQFLDGQHVAKMDESHRLGMATLQAQYLDSVTQRDSSLDSFARAMSELAAASKAPVG
GARVIPIMAQSAGAGSAAASPVVGAATEALVRYDIADQVKCTDCKTCYQDLPELFEKTRI
VVNGESRDVGQLIAGAMERIKVTPELKSRIKRVAANCDAEIIL
Download sequence
Identical sequences Q21TI5
338969.Rfer_3209 gi|89901978|ref|YP_524449.1| WP_011465481.1.86502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]