SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 338969.Rfer_3669 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  338969.Rfer_3669
Domain Number - Region: 40-87
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00034
Family NfeD domain-like 0.01
Further Details:      
 
Domain Number - Region: 154-227
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0163
Family Single strand DNA-binding domain, SSB 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 338969.Rfer_3669
Sequence length 237
Comment (Rhodoferax ferrireducens T118)
Sequence
MLTKDESMKNLLLVCLLAATPFATSSWAADKSAPVAPAAAGVSGEVLEVKDVEMYSYLRL
KTKDGEIWAAVSKAPIKVGAKVTIENSTTMTNFESKTLKKTFPKILFGSLGGTGQALAGA
PAAVAKVVDTSPIKVAKASGANARTVAEVITKATELKDKPVRVSGKVVKYNGGIMGKNWI
HLRDGTGQEADGTNDVLVTTAAEAKVGAVVTVTGVVRTNKDFGSGYSYKVLIEDAKL
Download sequence
Identical sequences Q21S84
gi|89902429|ref|YP_524900.1| WP_011465932.1.86502 338969.Rfer_3669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]