SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 339670.Bamb_1574 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339670.Bamb_1574
Domain Number 1 Region: 109-265
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.88e-21
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0025
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.76e-19
Family Duplicated SiR/NiR-like domains 1 and 3 0.0069
Further Details:      
 
Domain Number 3 Region: 279-351
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000000000000785
Family Duplicated SiR/NiR-like domains 1 and 3 0.0081
Further Details:      
 
Domain Number 4 Region: 360-451
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000000000288
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 339670.Bamb_1574
Sequence length 463
Comment (Burkholderia cepacia AMMD)
Sequence
MRPSACPGLVRVVAAADGGLCRIKLPGGRLDARQARAIAAAARSYGSGAIDATNRANLQL
RGIRDGAADALAGALLDAGLGPRTSAADAADAANAADVAQDKAALAASDDVRNLMLSPLA
GLDPAALLDSRALARPLLDMLTHEPRRGELSPKFSIQLDGGESVAALDHPHDIWLAARRR
GDGALRIAAGLAGCPPVSSDDSPAWFDVAPDQAVALVRALLLAFLDLAPADVTRMRALLA
TGGERALRERAQHYAPFPLAADPALAGWRRMPADAALRFGARPSLDAARCSVGAQFVLGR
LDATQLERLAALAEAEGDATLSMTPWQGVFVHGVRRERAPVVLDALASLGLVCTPSDPLA
ALVACTGSAGCAKARADTKHDALALAARVGHPVDVHLTGCERHCALPHPATYTLVAVAPA
RYDLYRRDAATGLGAPLARHLTIDQAAARLTDLRHSQDTTTDA
Download sequence
Identical sequences Q0BFE1
WP_011656861.1.34573 WP_011656861.1.59090 339670.Bamb_1574 gi|115351627|ref|YP_773466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]