SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 339670.Bamb_2719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339670.Bamb_2719
Domain Number 1 Region: 95-361
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.36e-79
Family D-glucarate dehydratase-like 0.0000509
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.57e-32
Family Enolase N-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 339670.Bamb_2719
Sequence length 382
Comment (Burkholderia cepacia AMMD)
Sequence
MKIIRLETFVVPPRWLFLKIETDEGIVGWGEPVVEGRAHTVEAAVQELADYLVGKDPLLI
EDHWQVMYRAGFYRGGPIMMSAIAGVDQALWDIKGKHHGVPVHALLGGQVRDRIKVYSWI
GGDRPSDVANNARAVVERGFKAVKMNGSEELQIVDTYDKVEQVIANVAAVRDAVGPHVGI
GVDFHGRVHKPMAKVLAKELDPYKLMFIEEPVLSENAEALRDIVNQTNTPIALGERLYSR
WDFKHILAGGYVDIIQPDASHAGGITECRKIATLAESYDVALALHCPLGPIALAACLQLD
AVSYNAFIQEQSLGIHYNQGNDLLDYLRNPEVFRYEDGFVAIPQGPGLGIDVNEEKVREM
AKTGHRWRNPVWRHADGSVAEW
Download sequence
Identical sequences B1FDL1 B1YW07 Q0BC48
gi|115352770|ref|YP_774609.1| gi|172061632|ref|YP_001809284.1| WP_006751313.1.34573 WP_006751313.1.40091 WP_006751313.1.54386 WP_006751313.1.59090 339670.Bamb_2719 398577.BamMC406_2591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]