SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 339670.Bamb_2991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339670.Bamb_2991
Domain Number 1 Region: 118-297
Classification Level Classification E-value
Superfamily E set domains 7.46e-61
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000283
Further Details:      
 
Domain Number 2 Region: 34-148
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.44e-23
Family Voltage-gated potassium channels 0.0000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 339670.Bamb_2991
Sequence length 321
Comment (Burkholderia cepacia AMMD)
Sequence
MNVDSSSPASRGRGRKLWSGTRPVVAYGMPPLGWRDLYHRALTVSWPVFFLSLAILFLLL
NGGFAALYLLGHDAIANQSPAGFVGAFFFSVETLATVGYGDMHPQSVYAHVVSTFEIFIG
MSGIALATGLVFARFSRPQAKILFARLAIVRPLNGRMTLMVRAANARQNVIAEAQAKLRL
MRVEGTHEGYTLRKIHDLPLVRSEHPIFLLGWNLMHVIDETSPLFGETAESLAARDATLL
ITIEGSDETTAQVMQARYSWTHADIRWRHRYVDLMHDEDGITHIDYTHFHEVVPVDAESD
ERGSPGVIESGPAAQASGPAA
Download sequence
Identical sequences Q0BBC6
gi|115353042|ref|YP_774881.1| 339670.Bamb_2991 WP_011658077.1.34573 WP_011658077.1.59090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]