SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 339670.Bamb_4421 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339670.Bamb_4421
Domain Number 1 Region: 22-162
Classification Level Classification E-value
Superfamily Regulatory protein AraC 1.57e-18
Family Regulatory protein AraC 0.012
Further Details:      
 
Domain Number 2 Region: 180-230
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000188
Family AraC type transcriptional activator 0.019
Further Details:      
 
Domain Number 3 Region: 232-279
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000283
Family AraC type transcriptional activator 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 339670.Bamb_4421
Sequence length 286
Comment (Burkholderia cepacia AMMD)
Sequence
MTTAAKNPDTRDHWLVARRDAETGIESLHAHFNGHAYDAHDHDDMLVGFTEQGVQRFQCH
RSLHTSVPGRAILIEPGAMHDGHAPEAGGFTYGMLYLPQAWVERAARRLDLPGLGSVEAA
FGHTLVDDRGLVDAIRHAFVAIHGNEGRLARDQTLDRLLTRLGGELRGAPLALESSVVPP
AIARVRDLLHAHMDGNLGLDELAGAAGIDRFRLTRLFQRAYGTSPHAYLVRLRLRAARRL
LAAGRTPAQAAADVGFADQSHLGRWFRRAYRITPAAYRQLCTNVPD
Download sequence
Identical sequences Q0B7A0
339670.Bamb_4421 WP_011659401.1.34573 WP_011659401.1.59090 gi|115359169|ref|YP_776307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]