SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 339670.Bamb_6435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339670.Bamb_6435
Domain Number 1 Region: 726-967
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.01e-21
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.021
Further Details:      
 
Domain Number 2 Region: 437-623
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000448
Family Pyruvate oxidase and decarboxylase PP module 0.038
Further Details:      
 
Domain Number 3 Region: 20-233
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000005
Family Pyruvate oxidase and decarboxylase Pyr module 0.037
Further Details:      
 
Domain Number 4 Region: 273-373
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.00000199
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 339670.Bamb_6435
Sequence length 1168
Comment (Burkholderia cepacia AMMD)
Sequence
MGAIDTSFTADAKYSRSDGRILLTGIEALVRLPMLQRQWDEAHGLSTAGLISGYRGSPLG
AYDQQLWKASQQLAAHDIVFQPGLNEDLAATALWGAQMHRAFGQARVDGVFGIWYGKGPG
VDRSGDVLRTGNVLGTSKLGGVLAVSGDDHAAQSSMYPHQTDGIFQSASIPVLQPANVRE
VIELGLSGLALSRFSGLWVGLKTIAEVVETAASFELGPLPRFKIPQDFLMPPHGLNWDPS
LQWPAQRAELERRLIEERLPAARAWARANMLDRIVVAAPQRRLGIITVGKAHQDVMQAAA
DLGLSRRDLEQLGISVYKVAMSWPLETEGALAFAEGHDEVLVVEEKRSVVEAQIKDALYH
CPAARRPRVTGKTTERGAQLLPEVSEFDPRLLARVLVMRIEAVGIEAPILTNRLAALQTP
QKALPSGVIPVRKPYFCSGCPHNTSTRTPDGSISGGGIGCHVMALQQPWLKTHTFSQMGG
EGLQWVGAAPFSTTKHTFQNLGDGTYQHSGLLAIRAAVAAKTNITYKILYNDAVAMTGGQ
PAEGVIDPARITRQLHAEGVARIAMVSDDPMRWTGNKELADGVAVHHREELDAVQRTFRD
IPGVTAIVYEQTCAAEKRRRRKRGTMSDPNRRVFINHRVCEGCGDCSVQSNCISVEPLAT
PYGRKRKINQSACNKDFSCLKGFCPSFVEIEGAKLRKPDGARLNALEAELGNGLQSPTVP
TITAPFNVYVAGIGGTGVLTMGALIGGAAHLEGKGMTVLDFTGLAQKNGAVVSQVRIAPS
PDDIHAARISEASVDLLLGADLVVSSAAETLGKMSDGRSCAVVNLGATPTADLVHQRDAS
VPTPLMLERVQQRCRADRFHSLDASDAAQKVFGDTLPTHTMMLGYAWQKALLPLSREAIE
RAIELNGAAVDLNKRAFTWGRILAVHPHALDAVSDQGAKQSGSQTLEEVIKQHVADLTAY
QNAAYAHRYSALVVRARSAEQRVRPGSEVFATAVAVSAYRLMAYKDEYEVARLYGSDEFK
ASLASQFSEIGKMSLWLAPPLFSRIDPATGRPRKRKFGPWILSAMNTLARMRKLRGTPLD
VFGYTRERRVERQLVSEFFADIESVCTTLAAAGIERAAAFASLPQEIRGFGSVKATAMAT
HAKRRHEALIEMRNLASSPDRKEALPLA
Download sequence
Identical sequences Q0B1J4
339670.Bamb_6435 gi|115361176|ref|YP_778313.1| WP_011661305.1.34573 WP_011661305.1.59090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]