SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 339671.Asuc_0950 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  339671.Asuc_0950
Domain Number - Region: 119-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000235
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 339671.Asuc_0950
Sequence length 148
Comment (Actinobacillus succinogenes 130Z)
Sequence
MAWLTIWTAWHWLILGFVLLIAEILIPGIFLLWWGLAAIVVAGLMAFITALTLPVLGMIY
AILATIFSVLWWKYQHKRDLADEKLSVLNQRNNAMLASRGVVQDIGENGIGRGRFGDTTW
RIEGSELTVGDTVEVLAVKGITLIVKKI
Download sequence
Identical sequences A6VMX1
WP_012072695.1.63012 gi|152978624|ref|YP_001344253.1| 339671.Asuc_0950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]