SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 339860.Msp_0862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  339860.Msp_0862
Domain Number 1 Region: 133-408
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.34e-91
Family Enolase 0.0000026
Further Details:      
 
Domain Number 2 Region: 5-131
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.28e-41
Family Enolase N-terminal domain-like 0.000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 339860.Msp_0862
Sequence length 414
Comment (Methanosphaera stadtmanae)
Sequence
MDSVIEDVRLRKIIDSRGNPTVEADVLTWNGFGRAAAPSGASTGINEVTSFPDGGVDQVI
TDVEDLISSEIIGMEAEDIREIDNVLKEIDGTDNFSTIGGNTAVAVSMATAKAAASSYNL
PLYKFLGGIMPTQIPFPLGNMINGGAHAGTNAPDIQEFLVIPVGASNITEAITTNINVHR
RIKAKIQEKDKTFTGGKGDEGGWAPNLTNEEALEIQFTSCEEVSDETGVLVKPGLDVASS
EFWNEKEQKYVYEREGTSRTVEEQIDYIADLIDTYKFFYVEDPIQENDFEAFAELTSKSG
KDCLICGDDLFVTNAEILAKGIEAHAGNSLIIKPNQIGTLTDTYNTIKLAKANKYVPVVS
HRSGETTDETIAHLAVAFNAPIIKTGAAGGERIAKLNELVRIEEELLNPSMADL
Download sequence
Identical sequences A0A1D2W8E9 Q2NG02
WP_011406450.1.14142 WP_011406450.1.32456 gi|84489662|ref|YP_447894.1| 339860.Msp_0862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]